PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G78700.1
Common NameBEH4, F9K20.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BES1
Protein Properties Length: 325aa    MW: 34697.4 Da    PI: 7.3048
Description BES1/BZR1 homolog 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G78700.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822216.37.3e-6721451149
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslqss 97 
                  ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++++ e++e++g sa+asp+ss+q  
  AT1G78700.1   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCSRPvERMEIGGGSATASPCSSYQ-- 97 
                  5899**********************************************************************999*******************.. PP

       DUF822  98 lkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                        +sp++sy++sp ss+f+sp+s+++++l+s   +sl+p+l++ls++sss
  AT1G78700.1  98 ------PSPCASYNPSPGSSNFMSPASSSFANLTSGdgQSLIPWLKHLSTTSSS 145
                  ......**********************9999998788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.6E-643140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCSRPVER MEIGGGSATA SPCSSYQPSP CASYNPSPGS SNFMSPASSS  120
FANLTSGDGQ SLIPWLKHLS TTSSSSASSS SRLPNYLYIP GGSISAPVTP PLSSPTARTP  180
RMNTDWQQLN NSFFVSSTPP SPTRQIIPDS EWFSGIQLAQ SVPASPTFSL VSQNPFGFKE  240
EAASAAGGGG GSRMWTPGQS GTCSPAIPPG ADQTADVPMS EAVAPPEFAF GSNTNGLVKA  300
WEGERIHEES GSDDLELTLG NSSTR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.108910.0bud| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306993500.0
Genevisible264248_at0.0
Expression AtlasAT1G78700-
AtGenExpressAT1G78700-
ATTED-IIAT1G78700-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G78700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDbrassinosteroid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G78700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0903310.0AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0504300.0AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565187.10.0BES1/BZR1 homolog 4
SwissprotQ9ZV880.0BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLD7KVU20.0D7KVU2_ARALL; Putative uncharacterized protein
STRINGAT1G78700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP15951542
MalvidsOGEM19172781
Publications ? help Back to Top
  1. Wang ZY, et al.
    Nuclear-localized BZR1 mediates brassinosteroid-induced growth and feedback suppression of brassinosteroid biosynthesis.
    Dev. Cell, 2002. 2(4): p. 505-13
    [PMID:11970900]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Yin Y, et al.
    A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis.
    Cell, 2005. 120(2): p. 249-59
    [PMID:15680330]
  4. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  5. Wang Y, et al.
    Strigolactone/MAX2-induced degradation of brassinosteroid transcriptional effector BES1 regulates shoot branching.
    Dev. Cell, 2013. 27(6): p. 681-8
    [PMID:24369836]