PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G78540.1
Common NameATSHB, SHB, STATLB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family STAT
Protein Properties Length: 668aa    MW: 75811.7 Da    PI: 5.1785
Description SH2 domain protein B
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G78540.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT179.16.5e-562213401121
         STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfl 98 
                  ldv+l+na+gqpv+kdvevvasLlyad+ l+ +k+++aeapLLi+ +Gv+fss drp+kll+Gr+sfklkisqLss++d+rLf+ikf i++ k+ypfl
  AT1G78540.1 221 LDVLLSNAIGQPVHKDVEVVASLLYADT-LPEAKMGEAEAPLLIRDEGVQFSSDDRPIKLLNGRSSFKLKISQLSSNSDDRLFWIKFGIRNAKDYPFL 317
                  89*************************9.9******************************************************************** PP

         STAT  99 eavskpirCisrsrntrsssltk 121
                  +avs+pirCis s +++++s+t 
  AT1G78540.1 318 QAVSNPIRCISVSPEVQPVSVTP 340
                  *****************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2003.7E-624143IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498994.22E-829165IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF133856.5E-730143No hitNo description
CDDcd103382.93E-67563668No hitNo description
Gene3DG3DSA:3.30.505.101.0E-8570622IPR000980SH2 domain
SuperFamilySSF555502.96E-11571659IPR000980SH2 domain
PROSITE profilePS500019.485574642IPR000980SH2 domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
MASAATIETE KYSLLEDFNV DVEVDDEEYE SFSLCFWVYL LNSTTFPSTI IRQVHSDMSV  60
SAPFLVLDEN KKMMLLPLTL LHKEAPDPVD TSSWTQVPSV STKSKFPLEK WVHVGCEVSR  120
NFMRLFIDGN MEGEQFVTSL LTKNAYPECP RKISLFSVGG DGYSVQGFIQ CAEVLPASDH  180
VEHHYMKDPP LMLSVNKSSS SGIKLDDCGV WQASCKEMFS LDVLLSNAIG QPVHKDVEVV  240
ASLLYADTLP EAKMGEAEAP LLIRDEGVQF SSDDRPIKLL NGRSSFKLKI SQLSSNSDDR  300
LFWIKFGIRN AKDYPFLQAV SNPIRCISVS PEVQPVSVTP KRLTNIDHLS STESPDLLQN  360
TSSVKRIRLG KESVSGSEES YQQCNSHPQT SRQFENGNGM RLHEEDNSSI DSENSEMRYT  420
ISDSTIFKYC LGNLIDKALL LKEITNNSSD DEVLEFANQV SLYSGCSHHS YQINMARELI  480
AEGTNAWILI SRNNQHVHWD NVVYEIEEHF MRISKCSSRS LTHQDFELLR RISGCYEYIT  540
QENFEKMWCW LFPVAYSISR GLINGMWRSS SPKWIEGFIT KEEAEHSLQG QEPGTFILRF  600
PISRTWPHPD AGSLVVTYVG HDFALHHKQL KIDNICESSE RYMDAKPLQD MLLAEPELSR  660
LGRIKRSH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.342760.0seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G78540
AtGenExpressAT1G78540
Functional Description ? help Back to Top
Source Description
TAIREncodes a protein that contains an SH2 domain. It can pull down a 120-kD tyrosine-phosphorylated protein in vitro. It is predicted to act as a transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G78540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G78540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2215320.0AK221532.1 Arabidopsis thaliana mRNA for Hypothetical protein, complete cds, clone: RAFL07-69-D06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177975.30.0SH2 domain protein B
TrEMBLQ56XZ10.0Q56XZ1_ARATH; Putative uncharacterized protein At1g78540
STRINGAT1G78540.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Williams JG,Zvelebil M
    SH2 domains in plants imply new signalling scenarios.
    Trends Plant Sci., 2004. 9(4): p. 161-3
    [PMID:15063865]
  2. Gao Q, et al.
    Identification of the linker-SH2 domain of STAT as the origin of the SH2 domain using two-dimensional structural alignment.
    Mol. Cell Proteomics, 2004. 3(7): p. 704-14
    [PMID:15073273]
  3. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]