PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G77450.1
Common Nameanac032, NAC032, T5M16.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 253aa    MW: 28743.8 Da    PI: 8.6631
Description NAC domain containing protein 32
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G77450.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.83e-51111342128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                  ppGfrFhPtdeelv  yL++k++++++++  +i+e+d+y+++PwdLp ++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   + 
  AT1G77450.1  11 PPGFRFHPTDEELVLMYLCRKCASQPIPA-PIITELDLYRYDPWDLPDMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGR--PKP 105
                  9****************************.88***************6666689*************************************98..789 PP

          NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  vg+kk Lvfy+g+ p+gekt+W+mheyrl
  AT1G77450.1 106 VGIKKALVFYSGKPPNGEKTNWIMHEYRL 134
                  ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-616160IPR003441NAC domain
PROSITE profilePS5100559.74710160IPR003441NAC domain
PfamPF023655.2E-2711134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MMKSGADLQF PPGFRFHPTD EELVLMYLCR KCASQPIPAP IITELDLYRY DPWDLPDMAL  60
YGEKEWYFFS PRDRKYPNGS RPNRAAGTGY WKATGADKPI GRPKPVGIKK ALVFYSGKPP  120
NGEKTNWIMH EYRLADVDRS VRKKNSLRLD DWVLCRIYNK KGVIEKRRSD IEDGLKPVTD  180
TCPPESVARL ISGSEQAVSP EFTCSNGRLS NALDFPFNYV DAIADNEIVS RLLGGNQMWS  240
TTLDPLVVRQ GTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-78616611174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.178020.0floral meristem| flower| inflorescence| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306992580.0
Genevisible259705_at0.0
Expression AtlasAT1G77450-
AtGenExpressAT1G77450-
ATTED-IIAT1G77450-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in germinating seeds, roots, leaf veins, open flowers and silique stalks. {ECO:0000269|PubMed:27388337}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:26518251, ECO:0000269|PubMed:27388337}.
Function -- GeneRIF ? help Back to Top
  1. ANAC032 is an important transcription factor that positively regulates age-dependent and stress-induced senescence in A. thaliana by modulating reactive oxygen species production.
    [PMID: 27388337]
  2. ANAC032 enhances resistance to Pseudomonas syringae pv. tomato DC3000 (Pst) by generating an orchestrated transcriptional output towards key salicylic acid and jasmonic acid signalling genes coordinated through direct binding of ANAC032 to the MYC2, NIMIN1 and PDF1.2A promoters
    [PMID: 27632992]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G77450.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269|PubMed:26518251, ECO:0000269|PubMed:27388337}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G77450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1189850.0AK118985.1 Arabidopsis thaliana At1g77450 mRNA for GRAB1-like protein, complete cds, clone: RAFL21-32-D18.
GenBankBT0085380.0BT008538.1 Arabidopsis thaliana clone U51069 putative GRAB1 protein (At1g77450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177869.10.0NAC domain containing protein 32
SwissprotQ9CAR00.0NAC32_ARATH; NAC transcription factor 32
TrEMBLA0A178WMH10.0A0A178WMH1_ARATH; NAC032
TrEMBLA0A1B3IQ450.0A0A1B3IQ45_SOYBN; NAC transcription factor
STRINGAT1G77450.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yazaki J, et al.
    Transcriptional profiling of genes responsive to abscisic acid and gibberellin in rice: phenotyping and comparative analysis between rice and Arabidopsis.
    Physiol. Genomics, 2004. 17(2): p. 87-100
    [PMID:14982972]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Avivi Y, et al.
    Reorganization of specific chromosomal domains and activation of silent genes in plant cells acquiring pluripotentiality.
    Dev. Dyn., 2004. 230(1): p. 12-22
    [PMID:15108305]
  5. Hass C, et al.
    The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis.
    EMBO J., 2004. 23(16): p. 3290-302
    [PMID:15282545]
  6. Zhang W, et al.
    Cis-regulatory element based targeted gene finding: genome-wide identification of abscisic acid- and abiotic stress-responsive genes in Arabidopsis thaliana.
    Bioinformatics, 2005. 21(14): p. 3074-81
    [PMID:15890746]
  7. Vanderauwera S, et al.
    Genome-wide analysis of hydrogen peroxide-regulated gene expression in Arabidopsis reveals a high light-induced transcriptional cluster involved in anthocyanin biosynthesis.
    Plant Physiol., 2005. 139(2): p. 806-21
    [PMID:16183842]
  8. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  9. Nakano T, et al.
    Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana.
    J. Plant Res., 2006. 119(4): p. 407-13
    [PMID:16820983]
  10. Lu PL, et al.
    A novel drought-inducible gene, ATAF1, encodes a NAC family protein that negatively regulates the expression of stress-responsive genes in Arabidopsis.
    Plant Mol. Biol., 2007. 63(2): p. 289-305
    [PMID:17031511]
  11. Ikeda Y,Banno H,Niu QW,Howell SH,Chua NH
    The ENHANCER OF SHOOT REGENERATION 2 gene in Arabidopsis regulates CUP-SHAPED COTYLEDON 1 at the transcriptional level and controls cotyledon development.
    Plant Cell Physiol., 2006. 47(11): p. 1443-56
    [PMID:17056621]
  12. Bezhani S, et al.
    Unique, shared, and redundant roles for the Arabidopsis SWI/SNF chromatin remodeling ATPases BRAHMA and SPLAYED.
    Plant Cell, 2007. 19(2): p. 403-16
    [PMID:17293567]
  13. Ma S,Bohnert HJ
    Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression.
    Genome Biol., 2007. 8(4): p. R49
    [PMID:17408486]
  14. Gonzalez D,Bowen AJ,Carroll TS,Conlan RS
    The transcription corepressor LEUNIG interacts with the histone deacetylase HDA19 and mediator components MED14 (SWP) and CDK8 (HEN3) to repress transcription.
    Mol. Cell. Biol., 2007. 27(15): p. 5306-15
    [PMID:17526732]
  15. Peng M,Bi YM,Zhu T,Rothstein SJ
    Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA.
    Plant Mol. Biol., 2007. 65(6): p. 775-97
    [PMID:17885809]
  16. Kunieda T, et al.
    NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2631-42
    [PMID:18849494]
  17. Abdeen A,Schnell J,Miki B
    Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3.
    BMC Genomics, 2010. 11: p. 69
    [PMID:20105335]
  18. Inz
    A subcellular localization compendium of hydrogen peroxide-induced proteins.
    Plant Cell Environ., 2012. 35(2): p. 308-20
    [PMID:21443605]
  19. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  20. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  21. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  22. Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
    Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress.
    Plant Cell, 2014. 26(12): p. 4656-79
    [PMID:25549671]
  23. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  24. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  25. Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ
    ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana.
    Plant Cell Physiol., 2016. 57(10): p. 2029-2046
    [PMID:27388337]
  26. Allu AD,Brotman Y,Xue GP,Balazadeh S
    Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection.
    EMBO Rep., 2016. 17(11): p. 1578-1589
    [PMID:27632992]
  27. Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ
    The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses.
    Front Plant Sci, 2016. 7: p. 1548
    [PMID:27790239]
  28. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]