PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G76880.1
Common NameF7O12.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 603aa    MW: 67879 Da    PI: 6.6967
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G76880.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.22.6e-2961145187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe+laL+++r++m+ ++r+++ k+plWeevs+km+e+g+ r++k+Ckek+en+ k++k++keg+ ++++++  t+++fdqlea
  AT1G76880.1  61 RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAEHGYIRNAKKCKEKFENVYKYHKRTKEGRTGKSEGK--TYRFFDQLEA 145
                  8********************************************************************975544..6*******85 PP

2trihelix105.34.5e-33408493187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k e+ aLi++r++++++++++  k+plWee+s+ mr+ gf+r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  AT1G76880.1 408 RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 493
                  8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.08758120IPR001005SANT/Myb domain
PfamPF138373.2E-1860146No hitNo description
CDDcd122032.17E-2260125No hitNo description
PROSITE profilePS500906.95760118IPR017877Myb-like domain
PROSITE profilePS500907.294401465IPR017877Myb-like domain
SMARTSM007170.0017405467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-4406464IPR009057Homeodomain-like
PfamPF138373.4E-22407494No hitNo description
CDDcd122033.37E-27407472No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010192Biological Processmucilage biosynthetic process
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MMQLGGGTPT TTAAATTVTT ATAPPPQSNN NDSAATEAAA AAVGAFEVSE EMHDRGFGGN  60
RWPRQETLAL LKIRSDMGIA FRDASVKGPL WEEVSRKMAE HGYIRNAKKC KEKFENVYKY  120
HKRTKEGRTG KSEGKTYRFF DQLEALESQS TTSLHHHQQQ TPLRPQQNNN NNNNNNNNSS  180
IFSTPPPVTT VMPTLPSSSI PPYTQQINVP SFPNISGDFL SDNSTSSSSS YSTSSDMEMG  240
GGTATTRKKR KRKWKVFFER LMKQVVDKQE ELQRKFLEAV EKREHERLVR EESWRVQEIA  300
RINREHEILA QERSMSAAKD AAVMAFLQKL SEKQPNQPQP QPQPQQVRPS MQLNNNNQQQ  360
PPQRSPPPQP PAPLPQPIQA VVSTLDTTKT DNGGDQNMTP AASASSSRWP KVEIEALIKL  420
RTNLDSKYQE NGPKGPLWEE ISAGMRRLGF NRNSKRCKEK WENINKYFKK VKESNKKRPE  480
DSKTCPYFHQ LDALYRERNK FHSNNNIAAS SSSSGLVKPD NSVPLMVQPE QQWPPAVTTA  540
TTTPAAAQPD QQSQPSEQNF DDEEGTDEEY DDEDEEEENE EEEGGEFELV PSNNNNNKTT  600
NNL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1246251RKKRKR
2246252RKKRKRK
3247252KKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.701050.0bud| flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864958770.0
Genevisible256331_at0.0
Expression AtlasAT1G76880-
AtGenExpressAT1G76880-
ATTED-IIAT1G76880-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G76880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G76880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2301520.0AK230152.1 Arabidopsis thaliana mRNA for hypothetical protein, partial sequence., clone: RAFL22-85-G13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177814.10.0Duplicated homeodomain-like superfamily protein
SwissprotQ391171e-144TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLQ9C6K30.0Q9C6K3_ARATH; Duplicated homeodomain-like superfamily protein
STRINGAT1G76880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
MalvidsOGEM48492553
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]
  3. Bechtold U, et al.
    Impact of chloroplastic- and extracellular-sourced ROS on high light-responsive gene expression in Arabidopsis.
    J. Exp. Bot., 2008. 59(2): p. 121-33
    [PMID:18212028]
  4. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  5. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  6. Voiniciuc C,Yang B,Schmidt MH,G
    Starting to gel: how Arabidopsis seed coat epidermal cells produce specialized secondary cell walls.
    Int J Mol Sci, 2015. 16(2): p. 3452-73
    [PMID:25658798]