PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G76320.2
Common NameCPD25, F15M4.18, FRS4, T23E18.25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 730aa    MW: 84952.2 Da    PI: 7.0878
Description FAR1-related sequence 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G76320.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1842.3e-261297291
         FAR1  2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                 fY++YAk+vGF + k +s++s+ ++e+++++f C ++g++++++++     ++ra+ ++gCka+++vk++ dgkw+v+++++eHnH+l p
  AT1G76320.2 12 FYKDYAKSVGFGTAKLSSRRSRASKEFIDAKFSCIRYGSKQQSDDA----INPRASPKIGCKASMHVKRRPDGKWYVYSFVKEHNHDLLP 97
                 9****************************************99887....9************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.5E-241297IPR004330FAR1 DNA binding domain
PfamPF105513.2E-25212304IPR018289MULE transposase domain
PROSITE profilePS5096610.546490526IPR007527Zinc finger, SWIM-type
PfamPF044342.6E-9490524IPR007527Zinc finger, SWIM-type
SMARTSM005753.4E-8501528IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MEFETHEDAY LFYKDYAKSV GFGTAKLSSR RSRASKEFID AKFSCIRYGS KQQSDDAINP  60
RASPKIGCKA SMHVKRRPDG KWYVYSFVKE HNHDLLPEQA HYFRSHRNTE LVKSNDSRLR  120
RKKNTPLTDC KHLSAYHDLD FIDGYMRNQH DKGRRLVLDT GDAEILLEFL MRMQEENPKF  180
FFAVDFSEDH LLRNVFWVDA KGIEDYKSFS DVVSFETSYF VSKYKVPLVL FVGVNHHVQP  240
VLLGCGLLAD DTVYTYVWLM QSWLVAMGGQ KPKVMLTDQN NAIKAAIAAV LPETRHCYCL  300
WHVLDQLPRN LDYWSMWQDT FMKKLFKCIY RSWSEEEFDR RWLKLIDKFH LRDVPWMRSL  360
YEERKFWAPT FMRGITFAGL SMRCRSESVN SLFDRYVHPE TSLKEFLEGY GLMLEDRYEE  420
EAKADFDAWH EAPELKSPSP FEKQMLLVYS HEIFRRFQLE VLGAAACHLT KESEEGTTYS  480
VKDFDDEQKY LVDWDEFKSD IYCSCRSFEY KGYLCRHAIV VLQMSGVFTI PINYVLQRWT  540
NAARNRHQIS RNLELVQSNI RRFNDLCRRA IILGEEGSLS QESYDIAMFA MKEAFKQCAV  600
TINTIKHPAR CEEAAIQAGD PVQEENQYGS TSTQIGPEPN IHAGNVPWQA ETRREKRSSL  660
NNTSKKHVAQ SETVGEGSQE GFQHVADPRQ SQAVLAGQFH NTMPGVFQNL INTNFQNIPA  720
TNMHQNNPPG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.346720.0flower| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261781_at0.0
Expression AtlasAT1G76320-
AtGenExpressAT1G76320-
ATTED-IIAT1G76320-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Function -- GeneRIF ? help Back to Top
  1. FRS4/CPD25 and FHY3/CPD45 function as a heterodimer that cooperatively activates ARC5.
    [PMID: 23662592]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G76320.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G76320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0104560.0BT010456.1 Arabidopsis thaliana far-red impaired response protein -related (At1g76320) mRNA, complete cds.
GenBankAK2214060.0AK221406.1 Arabidopsis thaliana mRNA for putative phytochrome A signaling protein, complete cds, clone: RAFL25-49-E06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031286.10.0protein FAR1-related sequence 4
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLR0I6J30.0R0I6J3_9BRAS; Uncharacterized protein
STRINGAT1G76320.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  2. Lin R,Wang H
    Arabidopsis FHY3/FAR1 gene family and distinct roles of its members in light control of Arabidopsis development.
    Plant Physiol., 2004. 136(4): p. 4010-22
    [PMID:15591448]
  3. Gao Y, et al.
    Arabidopsis FRS4/CPD25 and FHY3/CPD45 work cooperatively to promote the expression of the chloroplast division gene ARC5 and chloroplast division.
    Plant J., 2013. 75(5): p. 795-807
    [PMID:23662592]