PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G75430.1
Common NameBLH11, F1B16.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 290aa    MW: 33023.5 Da    PI: 6.1076
Description BEL1-like homeodomain 11
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G75430.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox314.3e-102212591854
                  HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  lF+   ++yp+++e+  LA+++gL+++qV++WF N R +
  AT1G75430.1 221 LFQHflHPYPNEAEKLVLASQTGLSKNQVSNWFINARVR 259
                  5775569******************************98 PP

2BELL107.39.4e-3581152172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  e++e+++k++kLlsll++V++r++qy++ql++vissFe++ag gs+k+Yt lAl+a++rhF +L++ai++q+
  AT1G75430.1  81 ENHEIHIKITKLLSLLQQVEERFEQYCNQLEQVISSFEEIAGEGSSKVYTGLALQAMTRHFGSLEEAIISQL 152
                  689******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-1311150IPR006563POX domain
PfamPF075261.6E-3017148IPR006563POX domain
SMARTSM003899.7E-10203267IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-27208269IPR009057Homeodomain-like
CDDcd000867.25E-11209264No hitNo description
SuperFamilySSF466894.71E-18209271IPR009057Homeodomain-like
PfamPF059201.9E-17220259IPR008422Homeobox KN domain
PROSITE profilePS5007111.791222263IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEDFRVRHEC SSLRGTLLDS RYAKAVQCLV EEVIDIGGRE VELCNNILIN QLFPGRRRPG  60
FALSSEIKSE LCSSGFMSLP ENHEIHIKIT KLLSLLQQVE ERFEQYCNQL EQVISSFEEI  120
AGEGSSKVYT GLALQAMTRH FGSLEEAIIS QLNSVRRRFI ISHQDVPKII SSGLSQLSLF  180
DGNTTSSSLQ RLGLVQGPQR HAWKPIRGLP ETSVAILRAW LFQHFLHPYP NEAEKLVLAS  240
QTGLSKNQVS NWFINARVRL WKPMIEEMYR EEFGDSLDES MQREANDDSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-18209270566Homeobox protein Meis2
3k2a_B8e-18209270566Homeobox protein Meis2
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453375780.0
Genevisible261111_at1e-159
Expression AtlasAT1G75430-
AtGenExpressAT1G75430-
ATTED-IIAT1G75430-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G75430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G75430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464320.0DQ446432.1 Arabidopsis thaliana clone pENTR221-At1g75430 homeodomain-containing protein (At1g75430) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177676.20.0BEL1-like homeodomain 11
SwissprotQ1PFD10.0BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLC0SV320.0C0SV32_ARATH; Putative uncharacterized protein At1g75430 (Fragment)
STRINGAT1G75430.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MalvidsOGEM97362734
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Bhatt AM,Etchells JP,Canales C,Lagodienko A,Dickinson H
    VAAMANA--a BEL1-like homeodomain protein, interacts with KNOX proteins BP and STM and regulates inflorescence stem growth in Arabidopsis.
    Gene, 2004. 328: p. 103-11
    [PMID:15019989]
  3. Smith HM,Campbell BC,Hake S
    Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH.
    Curr. Biol., 2004. 14(9): p. 812-7
    [PMID:15120075]
  4. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  5. Kumar R, et al.
    The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins.
    Plant Cell, 2007. 19(9): p. 2719-35
    [PMID:17873098]
  6. Johnston AJ, et al.
    Genetic subtraction profiling identifies genes essential for Arabidopsis reproduction and reveals interaction between the female gametophyte and the maternal sporophyte.
    Genome Biol., 2007. 8(10): p. R204
    [PMID:17915010]
  7. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]