PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G75410.2
Common NameBLH3, F1B16.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 524aa    MW: 59678.9 Da    PI: 6.7304
Description BEL1-like homeodomain 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G75410.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.81.1e-093664031954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+++e+  L+k++gL+++qV +WF N R +
  AT1G75410.2 366 FEHflHPYPKESEKIMLSKQTGLSKNQVANWFINARVR 403
                  665559******************************88 PP

2BELL125.42.1e-40229300172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+v+glg+akpYts+Al++iSrhFrcL+dai+eqi
  AT1G75410.2 229 ERQELQSKKSKLLTMVDEVDKRYNQYHHQMEALASSFEMVTGLGAAKPYTSVALNRISRHFRCLRDAIKEQI 300
                  79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-52162298IPR006563POX domain
PfamPF075261.2E-47168296IPR006563POX domain
PROSITE profilePS5007112.066344407IPR001356Homeobox domain
CDDcd000863.63E-11347408No hitNo description
SMARTSM003891.9E-9347411IPR001356Homeobox domain
SuperFamilySSF466893.38E-17348414IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-28350413IPR009057Homeodomain-like
PfamPF059201.8E-17364403IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MAVYYPNSVG MQSLYQESIY LNEQQQQQQQ ASSSSAASFS EIVSGDVRNN EMVFIPPTSD  60
VAVNGNVTVS SNDLSFHGGG LSLSLGNQIQ SAVSVSPFQY HYQNLSNQLS YNNLNPSTMS  120
DENGKSLSVH QHHSDQILPS SVYNNNGNNG VGFYNNYRYE TSGFVSSVLR SRYLKPTQQL  180
LDEVVSVRKD LKLGNKKMKN DKGQDFHNGS SDNITEDDKS QSQELSPSER QELQSKKSKL  240
LTMVDEVDKR YNQYHHQMEA LASSFEMVTG LGAAKPYTSV ALNRISRHFR CLRDAIKEQI  300
QVIRGKLGER ETSDEQGERI PRLRYLDQRL RQQRALHQQL GMVRPAWRPQ RGLPENSVSI  360
LRAWLFEHFL HPYPKESEKI MLSKQTGLSK NQVANWFINA RVRLWKPMIE EMYKEEFGES  420
AELLSNSNQD TKKMQETSQL KHEDSSSSQQ QNQGNNNNNI PYTSDAEQNL VFADPKPDRA  480
TTGDYDSLMN YHGFGIDDYN RYVGLGNQQD GRYSNPHQLH DFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-16353411563Homeobox protein Meis2
3k2a_B8e-16353411563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.162540.0flower| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261120_at0.0
Expression AtlasAT1G75410-
AtGenExpressAT1G75410-
ATTED-IIAT1G75410-
Functional Description ? help Back to Top
Source Description
TAIRBEL1-like homeodomain 3 (BLH3)
UniProtTranscription factor that is responsive of the nuclear import of SHOOT MERISTEMLESS (STM). {ECO:0000269|PubMed:16513846}.
Function -- GeneRIF ? help Back to Top
  1. the DNA-binding properties of the complex formed by the Arabidopsis TALE homeodomain (HD) proteins STM and BLH3
    [PMID: 19442701]
  2. These results support our assumption that, by interacting with OFP1, BLH3 forms a functional protein complex that controls timing of progression from vegetative to reproductive phase.
    [PMID: 26809096]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G75410.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G75410
IntActSearch Q9FWS9
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G75410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077827.10.0BEL1-like homeodomain 3
RefseqNP_177674.10.0BEL1-like homeodomain 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLD7KSP00.0D7KSP0_ARALL; Putative uncharacterized protein
STRINGAT1G75410.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Smith HM,Campbell BC,Hake S
    Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH.
    Curr. Biol., 2004. 14(9): p. 812-7
    [PMID:15120075]
  4. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  5. Cole M,Nolte C,Werr W
    Nuclear import of the transcription factor SHOOT MERISTEMLESS depends on heterodimerization with BLH proteins expressed in discrete sub-domains of the shoot apical meristem of Arabidopsis thaliana.
    Nucleic Acids Res., 2006. 34(4): p. 1281-92
    [PMID:16513846]
  6. Heyl A, et al.
    The transcriptional repressor ARR1-SRDX suppresses pleiotropic cytokinin activities in Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1380-95
    [PMID:18502977]
  7. Viola IL,Gonzalez DH
    Binding properties of the complex formed by the Arabidopsis TALE homeodomain proteins STM and BLH3 to DNA containing single and double target sites.
    Biochimie, 2009. 91(8): p. 974-81
    [PMID:19442701]
  8. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  9. Zhang L, et al.
    Ovate family protein1 interaction with BLH3 regulates transition timing from vegetative to reproductive phase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2016. 470(3): p. 492-7
    [PMID:26809096]