PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G75240.1
Common NameAtHB33, F22H5.4, HB33, ZHD5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ZF-HD
Protein Properties Length: 309aa    MW: 33892.8 Da    PI: 8.5774
Description homeobox protein 33
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G75240.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.41.5e-3272127258
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                   +vrY+eClkNhAas+Gg + DGCgEfmps geegt++al+CaAC+CHRnFHR+e++
  AT1G75240.1  72 PTVRYRECLKNHAASVGGSVHDGCGEFMPS-GEEGTIEALRCAACDCHRNFHRKEMD 127
                  579**************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2773127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.2E-2974126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.9E-3075126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.27676125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.608.3E-31232301IPR009057Homeodomain-like
SuperFamilySSF466891.51E-19234301IPR009057Homeodomain-like
TIGRFAMsTIGR015652.0E-29240297IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MDMRSHEMIE RRREDNGNNN GGVVISNIIS TNIDDNCNGN NNNTRVSCNS QTLDHHQSKS  60
PSSFSISAAA KPTVRYRECL KNHAASVGGS VHDGCGEFMP SGEEGTIEAL RCAACDCHRN  120
FHRKEMDGVG SSDLISHHRH HHYHHNQYGG GGGRRPPPPN MMLNPLMLPP PPNYQPIHHH  180
KYGMSPPGGG GMVTPMSVAY GGGGGGAESS SEDLNLYGQS SGEGAGAAAG QMAFSMSSSK  240
KRFRTKFTTD QKERMMDFAE KLGWRMNKQD EEELKRFCGE IGVKRQVFKV WMHNNKNNAK  300
KPPTPTTTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-232392991676ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.348020.0flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453375700.0
Genevisible256452_at0.0
Expression AtlasAT1G75240-
AtGenExpressAT1G75240-
ATTED-IIAT1G75240-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Binds DNA at 5'-ATTA-3' consensus promoter regions. Regulates floral architecture and leaf development. Regulators in the abscisic acid (ABA) signal pathway that confers sensitivity to ABA in an ARF2-dependent manner. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21779177}.
Function -- GeneRIF ? help Back to Top
  1. observations indicate that MIF1 regulates the ZHD5 activities in a dual step manner: nuclear import and DNA binding. [ZHD5]
    [PMID: 21059647]
  2. ARF2 and HB33 are novel regulators in the abscissic acid signal pathway, which has crosstalk with auxin signal pathway in regulating plant growth.
    [PMID: 21779177]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G75240.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by abscisic acid (ABA) and ARF2. {ECO:0000269|PubMed:21779177}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FRL5
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Increased resistance to abscisic acid (ABA) in the seed germination and primary root growth. {ECO:0000269|PubMed:21779177}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G75240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0258140.0AC025814.7 Arabidopsis thaliana chromosome 1 BAC F22H5 genomic sequence, complete sequence.
GenBankAK2290380.0AK229038.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-33-K14.
GenBankAY0844620.0AY084462.1 Arabidopsis thaliana clone 10873 mRNA, complete sequence.
GenBankBT0288940.0BT028894.1 Arabidopsis thaliana unknown protein (At1g75240) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565106.10.0homeobox protein 33
SwissprotQ9FRL50.0ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLA0A178WFZ40.0A0A178WFZ4_ARATH; ZHD5
STRINGAT1G75240.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72792543
Representative plantOGRP9116237
Publications ? help Back to Top
  1. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  2. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  3. Tran LS, et al.
    Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis.
    Plant J., 2007. 49(1): p. 46-63
    [PMID:17233795]
  4. Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
    Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance.
    Plant Physiol., 2007. 144(3): p. 1391-406
    [PMID:17478635]
  5. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  6. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]
  7. Han F,Zhu B
    Evolutionary analysis of three gibberellin oxidase genes in rice, Arabidopsis, and soybean.
    Gene, 2011. 473(1): p. 23-35
    [PMID:21056641]
  8. Hong SY,Kim OK,Kim SG,Yang MS,Park CM
    Nuclear import and DNA binding of the ZHD5 transcription factor is modulated by a competitive peptide inhibitor in Arabidopsis.
    J. Biol. Chem., 2011. 286(2): p. 1659-68
    [PMID:21059647]
  9. Wang L, et al.
    Auxin Response Factor2 (ARF2) and its regulated homeodomain gene HB33 mediate abscisic acid response in Arabidopsis.
    PLoS Genet., 2011. 7(7): p. e1002172
    [PMID:21779177]
  10. Mehrnia M,Balazadeh S,Zanor MI,Mueller-Roeber B
    EBE, an AP2/ERF transcription factor highly expressed in proliferating cells, affects shoot architecture in Arabidopsis.
    Plant Physiol., 2013. 162(2): p. 842-57
    [PMID:23616605]