PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G74480.1
Common NameAtRKD2, F1M20.16, RKD2, URP4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 298aa    MW: 33888 Da    PI: 6.6378
Description RWP-RK domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G74480.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK76.82.4e-24134182452
       RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ++s e++s+yF++pi++AA  L+v+lT+LKr+CR++GI+RWPhRk+ sl
  AT1G74480.1 134 TLSKETVSRYFYMPITQAAIALNVGLTLLKRRCRELGIRRWPHRKLMSL 182
                  7999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029121203IPR003035RWP-RK domain
PfamPF020422.0E-20134182IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020094anatomyplant egg cell
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MADHTTKEQK SFSFLAHSPS FDHSSLSYPL FDWEEDLLAL QENSGSQAFP FTTTSLPLPD  60
LEPLSEDVLN SYSSASWNET EQNRGDGASS EKKRENGTVK ETTKKRKINE RHREHSVRII  120
SDITTYTTSS APTTLSKETV SRYFYMPITQ AAIALNVGLT LLKRRCRELG IRRWPHRKLM  180
SLNTLISNVK ELQKMEGEEN AEKLQDALEM LEKEKRTIED LPDLEFKDKT KRLRQACFKA  240
NHKRKKKRSL KSDQSQVPSC SSSGSVPSDE SVDEAGMESD EEMKYLLCGF SSEFTSGL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
191106KKRENGTVKETTKKRK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184106230.0
Genevisible260212_at0.0
Expression AtlasAT1G74480-
AtGenExpressAT1G74480-
ATTED-IIAT1G74480-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00234DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G74480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G74480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0565180.0DQ056518.1 Arabidopsis thaliana RWP-RK domain-containing protein (At1g74480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177588.10.0RWP-RK domain-containing protein
SwissprotQ9CA660.0RKD2_ARATH; Protein RKD2
TrEMBLA0A178W9H30.0A0A178W9H3_ARATH; URP4
STRINGAT1G74480.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39662356
Representative plantOGRP5671777
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  3. Yu HJ,Hogan P,Sundaresan V
    Analysis of the female gametophyte transcriptome of Arabidopsis by comparative expression profiling.
    Plant Physiol., 2005. 139(4): p. 1853-69
    [PMID:16299181]
  4. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  5. Koszegi D, et al.
    Members of the RKD transcription factor family induce an egg cell-like gene expression program.
    Plant J., 2011. 67(2): p. 280-91
    [PMID:21457369]
  6. Waki T, et al.
    A GAL4-based targeted activation tagging system in Arabidopsis thaliana.
    Plant J., 2013. 73(3): p. 357-67
    [PMID:23057675]
  7. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]