PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G73870.1
Common NameBBX16, COL7, F2P9.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 392aa    MW: 44018.2 Da    PI: 4.6641
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G73870.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.45.8e-082263640
     zf-B_box  6 CpeHee.kelqlfCedCqqllCedClleeHkg......Htvv 40
                 C+ + +  +++++C  ++ +lC++C  ++H+       H++v
  AT1G73870.1 22 CDACMKrSRASWYCPADDAFLCQSCDASIHSAnhlakrHERV 63
                 *****9556********************9557666667665 PP

2CCT70.73.6e-24345388144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea++lRYkeKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  AT1G73870.1 345 REARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVKRT 388
                  9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.6E-111765IPR000315B-box-type zinc finger
PROSITE profilePS501199.5841765IPR000315B-box-type zinc finger
CDDcd000217.86E-92265No hitNo description
PfamPF006432.7E-62263IPR000315B-box-type zinc finger
PfamPF062032.3E-18345387IPR010402CCT domain
PROSITE profilePS5101716.142345387IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0010223Biological Processsecondary shoot formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MVVDVESRTA SVTGEKMAAR GCDACMKRSR ASWYCPADDA FLCQSCDASI HSANHLAKRH  60
ERVRLQSSSP TETADKTTSV WYEGFRRKAR TPRSKSCAFE KLLQIESNDP LVPELGGDED  120
DGFFSFSSVE ETEESLNCCV PVFDPFSDML IDDINGFCLV PDEVNNTTTN GELGEVEKAI  180
MDDEGFMGFV PLDMDLEDLT MDVESLLEEE QLCLGFKEPN DVGVIKEENK VGFEINCKDL  240
KRVKDEDEEE EEAKCENGGS KDSDREASND KDRKTSLFLR LDYGAVISAW DNHGSPWKTG  300
IKPECMLGGN TCLPHVVGGY EKLMSSDGSV TRQQGRDGGG SDGEREARVL RYKEKRRTRL  360
FSKKIRYEVR KLNAEQRPRI KGRFVKRTSL LT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1355371RRTRLFSKKIRYEVRKL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453375070.0
Genevisible260380_at0.0
Expression AtlasAT1G73870-
AtGenExpressAT1G73870-
ATTED-IIAT1G73870-
Function -- GeneRIF ? help Back to Top
  1. COL7 promotes hypocotyl elongation in response to shade.
    [PMID: 23314820]
  2. photo-excited phyB is required for stabilization of the COL7 protein
    [PMID: 24908267]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G73870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9C9A9
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G73870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0201830.0BT020183.1 Arabidopsis thaliana At1g73870 mRNA, complete cds.
GenBankBT0157400.0BT015740.1 Arabidopsis thaliana At1g73870 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177528.10.0zinc finger protein CONSTANS-LIKE 7
SwissprotQ9C9A90.0COL7_ARATH; Zinc finger protein CONSTANS-LIKE 7
TrEMBLD7KRN20.0D7KRN2_ARALL; Zinc finger (B-box type) family protein
STRINGAT1G73870.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1750679
Representative plantOGRP8021649
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. S
    ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis.
    Plant J., 2004. 38(3): p. 381-95
    [PMID:15086800]
  6. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  7. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  8. Gong W, et al.
    The development of protein microarrays and their applications in DNA-protein and protein-protein interaction analyses of Arabidopsis transcription factors.
    Mol Plant, 2008. 1(1): p. 27-41
    [PMID:19802365]
  9. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Wang H, et al.
    CONSTANS-LIKE 7 regulates branching and shade avoidance response in Arabidopsis.
    J. Exp. Bot., 2013. 64(4): p. 1017-24
    [PMID:23314820]
  12. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  13. Zhang Z, et al.
    CONSTANS-LIKE 7 (COL7) is involved in phytochrome B (phyB)-mediated light-quality regulation of auxin homeostasis.
    Mol Plant, 2014. 7(9): p. 1429-40
    [PMID:24908267]