PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G73730.1
Common NameAtEIL3, ATSLIM, EIL3, F25P22.15, SLIM1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family EIL
Protein Properties Length: 567aa    MW: 64041.5 Da    PI: 5.1139
Description ETHYLENE-INSENSITIVE3-like 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G73730.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3434.88.2e-133384011351
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  ++l++rmwkd+++lkr+ker+k      + a  +++ +k+++qa+rkkmsraQDgiLkYMlk mevc+++GfvYgiipekgkpv+g+sd++raWWkek
  AT1G73730.1  38 DDLERRMWKDRVRLKRIKERQKAGS---QGAQTKETPKKISDQAQRKKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWWKEK 132
                  79********************854...3445678899************************************************************ PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fd+ngpaai+ky+ ++l++++++++    ++++  l++lqD+tlgSLLs+lmqhcdppqr++plekg++pPWWPtG+e+ww +lgl+k+q+ ppy+
  AT1G73730.1 133 VKFDKNGPAAIAKYEEECLAFGKSDGN----RNSQFVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGNEEWWVKLGLPKSQS-PPYR 225
                  *********************987777....77999*********************************************************.9*** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX......XXXX....XXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss......slrk....qspkvtlsceqke 282
                  kphdlkk+wkv+vLtavi+hm p+i++i++++rqsk+lqdkm+akes+++l+vlnqee+++++ s++  +s         +    +++k ++++++++
  AT1G73730.1 226 KPHDLKKMWKVGVLTAVINHMLPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLIQQPSSDngNSnvtethR--RgnnaDRRKPVVNSDSDY 321
                  *******************************************************************66226887540..3344477888999999** PP

                  XXXXXXXXX.XXXXXXXXXX..................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXX CS
         EIN3 283 dvegkkeskikhvqavktta..................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisq 351
                  dv+g++e + + ++++++++                  +++ +r+rk+++ +s +v       + q+++ ++ ++++i++d+n+++ 
  AT1G73730.1 322 DVDGTEEASGSVSSKDSRRNqiqkeqptaishsvrdqdKAEKHRRRKRPRIRSGTV-------NRQEEEQPEAQQRNILPDMNHVDA 401
                  ***88888888888888777899999999977555544444444444444444444.......445566667899999999999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.1E-12638283No hitNo description
Gene3DG3DSA:1.10.3180.107.6E-71159291IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.27E-60164286IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MGDLAMSVAD IRMENEPDDL ASDNVAEIDV SDEEIDADDL ERRMWKDRVR LKRIKERQKA  60
GSQGAQTKET PKKISDQAQR KKMSRAQDGI LKYMLKLMEV CKVRGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGP AAIAKYEEEC LAFGKSDGNR NSQFVLQDLQ DATLGSLLSS  180
LMQHCDPPQR KYPLEKGTPP PWWPTGNEEW WVKLGLPKSQ SPPYRKPHDL KKMWKVGVLT  240
AVINHMLPDI AKIKRHVRQS KCLQDKMTAK ESAIWLAVLN QEESLIQQPS SDNGNSNVTE  300
THRRGNNADR RKPVVNSDSD YDVDGTEEAS GSVSSKDSRR NQIQKEQPTA ISHSVRDQDK  360
AEKHRRRKRP RIRSGTVNRQ EEEQPEAQQR NILPDMNHVD APLLEYNING THQEDDVVDP  420
NIALGPEDNG LELVVPEFNN NYTYLPLVNE QTMMPVDERP MLYGPNPNQE LQFGSGYNFY  480
NPSAVFVHNQ EDDILHTQIE MNTQAPPHNS GFEEAPGGVL QPLGLLGNED GVTGSELPQY  540
QSGILSPLTD LDFDYGGFGD DFSWFGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A2e-871632949140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453375010.0
Genevisible260064_at0.0
Expression AtlasAT1G73730-
AtGenExpressAT1G73730-
ATTED-IIAT1G73730-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor involved in ethylene signalling. Isolated DNA binding domain has been shown to bind DNA in vitro.
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Function -- GeneRIF ? help Back to Top
  1. DNA-binding domain NMR structure of EIL3
    [PMID: 15811366]
  2. SLIM1 functioned as a central transcriptional regulator, which controlled both the activation of sulfate acquisition and degradation of glucosinolates under -S conditions.
    [PMID: 17114350]
  3. SLIM1, both through the action of miR395 and independently, is responsible for the increased translocation of sulfate from roots to shoots during sulfate starvation, and also for the increased rate of sulfate reduction.
    [PMID: 21401744]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G73730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G16400(R), AT1G16410(R), AT1G78000(A), AT2G22330(R), AT3G19710(A), AT3G56040(R), AT4G31500(R), AT4G39950(A), AT5G43780(A), AT5G60890(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDethylene
Interaction ? help Back to Top
Source Intact With
IntActSearch O23116
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G73730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0042150.0AF004215.1 Arabidopsis thaliana ethylene-insensitive3-like3 (EIL3) mRNA, complete cds.
GenBankAY1338390.0AY133839.1 Arabidopsis thaliana clone U18784 putative ethylene-insensitive protein EIL3 (At1g73730) mRNA, complete cds.
GenBankAY0700440.0AY070044.1 Arabidopsis thaliana putative ethylene-insensitive protein EIL3 (At1g73730) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177514.10.0ethylene insensitive 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLD7KRL60.0D7KRL6_ARALL; Putative uncharacterized protein
STRINGAT1G73730.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46582548
Representative plantOGRP5631682
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Yamasaki K, et al.
    Solution structure of the major DNA-binding domain of Arabidopsis thaliana ethylene-insensitive3-like3.
    J. Mol. Biol., 2005. 348(2): p. 253-64
    [PMID:15811366]
  4. Wang J, et al.
    Genomewide nonadditive gene regulation in Arabidopsis allotetraploids.
    Genetics, 2006. 172(1): p. 507-17
    [PMID:16172500]
  5. Maruyama-Nakashita A,Nakamura Y,Tohge T,Saito K,Takahashi H
    Arabidopsis SLIM1 is a central transcriptional regulator of plant sulfur response and metabolism.
    Plant Cell, 2006. 18(11): p. 3235-51
    [PMID:17114350]
  6. Binder BM, et al.
    The Arabidopsis EIN3 binding F-Box proteins EBF1 and EBF2 have distinct but overlapping roles in ethylene signaling.
    Plant Cell, 2007. 19(2): p. 509-23
    [PMID:17307926]
  7. Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI
    HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana.
    New Phytol., 2008. 177(3): p. 627-42
    [PMID:18042203]
  8. Van der Ent S, et al.
    MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis.
    Plant Physiol., 2008. 146(3): p. 1293-304
    [PMID:18218967]
  9. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  10. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  11. Kawashima CG, et al.
    Sulphur starvation induces the expression of microRNA-395 and one of its target genes but in different cell types.
    Plant J., 2009. 57(2): p. 313-21
    [PMID:18801012]
  12. Okazaki Y, et al.
    A chloroplastic UDP-glucose pyrophosphorylase from Arabidopsis is the committed enzyme for the first step of sulfolipid biosynthesis.
    Plant Cell, 2009. 21(3): p. 892-909
    [PMID:19286968]
  13. Wawrzyńska A,Lewandowska M,Sirko A
    Nicotiana tabacum EIL2 directly regulates expression of at least one tobacco gene induced by sulphur starvation.
    J. Exp. Bot., 2010. 61(3): p. 889-900
    [PMID:20018902]
  14. Lewandowska M, et al.
    A contribution to identification of novel regulators of plant response to sulfur deficiency: characteristics of a tobacco gene UP9C, its protein product and the effects of UP9C silencing.
    Mol Plant, 2010. 3(2): p. 347-60
    [PMID:20147370]
  15. Garc
    Ethylene and nitric oxide involvement in the up-regulation of key genes related to iron acquisition and homeostasis in Arabidopsis.
    J. Exp. Bot., 2010. 61(14): p. 3885-99
    [PMID:20627899]
  16. Kawashima CG, et al.
    Interplay of SLIM1 and miR395 in the regulation of sulfate assimilation in Arabidopsis.
    Plant J., 2011. 66(5): p. 863-76
    [PMID:21401744]
  17. Chan PK,Biswas B,Gresshoff PM
    Classical ethylene insensitive mutants of the Arabidopsis EIN2 orthologue lack the expected 'hypernodulation' response in Lotus japonicus.
    J Integr Plant Biol, 2013. 55(4): p. 395-408
    [PMID:23452324]
  18. Luo J, et al.
    A DELLA gene, RhGAI1, is a direct target of EIN3 and mediates ethylene-regulated rose petal cell expansion via repressing the expression of RhCesA2.
    J. Exp. Bot., 2013. 64(16): p. 5075-84
    [PMID:24014864]
  19. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  20. Chao Q, et al.
    Activation of the ethylene gas response pathway in Arabidopsis by the nuclear protein ETHYLENE-INSENSITIVE3 and related proteins.
    Cell, 1997. 89(7): p. 1133-44
    [PMID:9215635]
  21. Solano R,Stepanova A,Chao Q,Ecker JR
    Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE-RESPONSE-FACTOR1.
    Genes Dev., 1998. 12(23): p. 3703-14
    [PMID:9851977]