PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G73360.1
Common NameAtEDT1, ATHDG11, EDT1, HDG11, HDGL2-11, T9L24.43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 722aa    MW: 79120.2 Da    PI: 6.6867
Description homeodomain GLABROUS 11
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G73360.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81e-193388156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 +++ +++t++q+++Le+ F+++++p++++r +L+++lgL  rq+k+WFqNrR++ k
  AT1G73360.1 33 KKRYHRHTAQQIQRLESSFKECPHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQLK 88
                 688999**********************************************9877 PP

2START157.21.3e-492374572206
                  HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
        START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                  +a++a++el+++ + +ep+W++     +++n   +   f++s +      +++ea+r sg+v+m+++ lv  ++d   +W+e ++    + +tl+vis
  AT1G73360.1 237 IALTAMEELLRLLQTNEPLWTRTDgcrDILNLGSYENVFPRSSNrgknqnFRVEASRSSGIVFMNAMALVDMFMDCV-KWTELFPsiiaASKTLAVIS 333
                  6899*******************999999999999999998888999999***************************.*******9**99******** PP

                  TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS.X CS
        START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgr.l 176
                  sg      gal+l + e+ +lsplv+ R+f  +Ry++q ++g+w++v vS d +q+++ +s++ R   +pSg+li++++ng+skvtwveh++ +++ l
  AT1G73360.1 334 SGmggtheGALHLLYEEMEVLSPLVAtREFCELRYCQQTEQGSWIVVNVSYDLPQFVS-HSQSYR---FPSGCLIQDMPNGYSKVTWVEHIETEEKeL 427
                  **********************************************************.999999...*************************87538 PP

                  XHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 177 phwllrslvksglaegaktwvatlqrqcek 206
                  +h+l+r ++++g+a+ga +wv tlqr ce+
  AT1G73360.1 428 VHELYREIIHRGIAFGADRWVTTLQRMCER 457
                  8***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.34E-201490IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-222084IPR009057Homeodomain-like
PROSITE profilePS5007118.1553090IPR001356Homeobox domain
SMARTSM003891.6E-183194IPR001356Homeobox domain
CDDcd000865.01E-193391No hitNo description
PfamPF000463.1E-173388IPR001356Homeobox domain
PROSITE patternPS0002706588IPR017970Homeobox, conserved site
PROSITE profilePS5084846.681227460IPR002913START domain
SuperFamilySSF559611.21E-32228459No hitNo description
CDDcd088754.50E-104231456No hitNo description
SMARTSM002343.3E-40236457IPR002913START domain
PfamPF018523.2E-42237457IPR002913START domain
Gene3DG3DSA:3.30.530.202.2E-7284425IPR023393START-like domain
SuperFamilySSF559613.71E-19478710No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008289Molecular Functionlipid binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000017anatomyvascular leaf primordium
PO:0000027anatomylateral root tip
PO:0000037anatomyshoot apex
PO:0000056anatomyflower bud
PO:0000230anatomyinflorescence meristem
PO:0000282anatomytrichome
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009073anatomystigma
PO:0020003anatomyplant ovule
PO:0020020anatomynucellus
PO:0020030anatomycotyledon
PO:0020041anatomystipule
PO:0020100anatomyhypocotyl
PO:0020148anatomyshoot apical meristem
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MSFVVGVGGS GSGSGGDGGG SHHHDGSETD RKKKRYHRHT AQQIQRLESS FKECPHPDEK  60
QRNQLSRELG LAPRQIKFWF QNRRTQLKAQ HERADNSALK AENDKIRCEN IAIREALKHA  120
ICPNCGGPPV SEDPYFDEQK LRIENAHLRE ELERMSTIAS KYMGRPISQL STLHPMHISP  180
LDLSMTSLTG CGPFGHGPSL DFDLLPGSSM AVGPNNNLQS QPNLAISDMD KPIMTGIALT  240
AMEELLRLLQ TNEPLWTRTD GCRDILNLGS YENVFPRSSN RGKNQNFRVE ASRSSGIVFM  300
NAMALVDMFM DCVKWTELFP SIIAASKTLA VISSGMGGTH EGALHLLYEE MEVLSPLVAT  360
REFCELRYCQ QTEQGSWIVV NVSYDLPQFV SHSQSYRFPS GCLIQDMPNG YSKVTWVEHI  420
ETEEKELVHE LYREIIHRGI AFGADRWVTT LQRMCERFAS LSVPASSSRD LGGVILSPEG  480
KRSMMRLAQR MISNYCLSVS RSNNTRSTVV SELNEVGIRV TAHKSPEPNG TVLCAATTFW  540
LPNSPQNVFN FLKDERTRPQ WDVLSNGNAV QEVAHISNGS HPGNCISVLR GSNATHSNNM  600
LILQESSTDS SGAFVVYSPV DLAALNIAMS GEDPSYIPLL SSGFTISPDG NGSNSEQGGA  660
STSSGRASAS GSLITVGFQI MVSNLPTAKL NMESVETVNN LIGTTVHQIK TALSGPTAST  720
TA
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425631980.0
Genevisible245726_at0.0
Expression AtlasAT1G73360-
AtGenExpressAT1G73360-
ATTED-IIAT1G73360-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During embryo development, expressed in all cells at the 4- and 16-cell embryo stages. Expression is restricted to the protoderm from the globular stage onward. {ECO:0000269|PubMed:25564655}.
UniprotTISSUE SPECIFICITY: Expressed in apical meristems and young epidermal tissue including trichomes and stipules. Expressed in lateral root tips, the L1 layer of apical inflorescence meristems and early flower primordia, carpel and petal epidermis, stigma papillae, ovule primordia, nucellus and embryo. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family. It is involved in trichome branching.
UniProtTranscription factor which acts as positive regulator of drought stress tolerance. Can transactivate CIPK3, NCED3 and ERECTA (PubMed:18451323). Transactivates several cell-wall-loosening protein genes by directly binding to HD motifs in their promoters. These target genes play important roles in coordinating cell-wall extensibility with root development and growth (PubMed:24821957). Transactivates CYP74A/AOS, AOC3, OPR3 and 4CLL5/OPCL1 genes by directly binding to HD motifs in their promoters. These target genes are involved in jasmonate (JA) biosynthesis, and JA signaling affects root architecture by activating auxin signaling, which promotes lateral root formation (PubMed:25752924). Acts as negative regulator of trichome branching (PubMed:16778018, PubMed:24824485). Required for the establishment of giant cell identity on the abaxial side of sepals (PubMed:23095885). May regulate cell differentiation and proliferation during root and shoot meristem development (PubMed:25564655). {ECO:0000269|PubMed:16778018, ECO:0000269|PubMed:18451323, ECO:0000269|PubMed:23095885, ECO:0000269|PubMed:24821957, ECO:0000269|PubMed:24824485, ECO:0000269|PubMed:25564655, ECO:0000269|PubMed:25752924}.
Function -- GeneRIF ? help Back to Top
  1. directly upregulates cell-wall-loosening protein genes
    [PMID: 24821957]
  2. overexpression of EDT1/HDG11 increases jasmonic acid level in the root of edt1D.
    [PMID: 25752924]
  3. AtHDG11 also confers drought and salt tolerance in upland cotton (Gossypium hirsutum) and woody plant poplar.
    [PMID: 25879154]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G73360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FX31
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Plants show excess branching of trichomes. {ECO:0000269|PubMed:16778018}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G73360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0039790.0BT003979.1 Arabidopsis thaliana clone RAFL15-10-L20 (R20587) putative homeobox protein (At1g73360) mRNA, complete cds.
GenBankBT0049150.0BT004915.1 Arabidopsis thaliana clone U20587 putative homeobox protein (At1g73360) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177479.10.0homeodomain GLABROUS 11
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A178W9A40.0A0A178W9A4_ARATH; HDG11
STRINGAT1G73360.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  5. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  6. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  7. Gao L,Xiang CB
    The genetic locus At1g73660 encodes a putative MAPKKK and negatively regulates salt tolerance in Arabidopsis.
    Plant Mol. Biol., 2008. 67(1-2): p. 125-34
    [PMID:18299802]
  8. Yu H, et al.
    Activated expression of an Arabidopsis HD-START protein confers drought tolerance with improved root system and reduced stomatal density.
    Plant Cell, 2008. 20(4): p. 1134-51
    [PMID:18451323]
  9. Cao YJ, et al.
    Ectopic overexpression of AtHDG11 in tall fescue resulted in enhanced tolerance to drought and salt stress.
    Plant Cell Rep., 2009. 28(4): p. 579-88
    [PMID:19132376]
  10. Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
    Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.
    Mol Plant, 2009. 2(4): p. 803-22
    [PMID:19626137]
  11. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  12. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  13. Roeder AH,Cunha A,Ohno CK,Meyerowitz EM
    Cell cycle regulates cell type in the Arabidopsis sepal.
    Development, 2012. 139(23): p. 4416-27
    [PMID:23095885]
  14. Yu L, et al.
    Arabidopsis enhanced drought tolerance1/HOMEODOMAIN GLABROUS11 confers drought tolerance in transgenic rice without yield penalty.
    Plant Physiol., 2013. 162(3): p. 1378-91
    [PMID:23735506]
  15. Xu P, et al.
    HDG11 upregulates cell-wall-loosening protein genes to promote root elongation in Arabidopsis.
    J. Exp. Bot., 2014. 65(15): p. 4285-95
    [PMID:24821957]
  16. Khosla A, et al.
    HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23.
    Plant Cell, 2014. 26(5): p. 2184-2200
    [PMID:24824485]
  17. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]
  18. Cai XT,Xu P,Wang Y,Xiang CB
    Activated expression of AtEDT1/HDG11 promotes lateral root formation in Arabidopsis mutant edt1 by upregulating jasmonate biosynthesis.
    J Integr Plant Biol, 2015. 57(12): p. 1017-30
    [PMID:25752924]
  19. Yu LH, et al.
    Arabidopsis EDT1/HDG11 improves drought and salt tolerance in cotton and poplar and increases cotton yield in the field.
    Plant Biotechnol. J., 2016. 14(1): p. 72-84
    [PMID:25879154]
  20. Zhu Z, et al.
    Overexpression of AtEDT1/HDG11 in Chinese Kale (Brassica oleracea var. alboglabra) Enhances Drought and Osmotic Stress Tolerance.
    Front Plant Sci, 2016. 7: p. 1285
    [PMID:27625663]
  21. Liu Y, et al.
    Overexpression of AtEDT1 promotes root elongation and affects medicinal secondary metabolite biosynthesis in roots of transgenic Salvia miltiorrhiza.
    Protoplasma, 2017. 254(4): p. 1617-1625
    [PMID:27915455]
  22. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  23. Lung SC, et al.
    Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
    New Phytol., 2018. 218(1): p. 183-200
    [PMID:29288621]
  24. Zheng G, et al.
    Over-Expression of Arabidopsis EDT1 Gene Confers Drought Tolerance in Alfalfa (Medicago sativa L.).
    Front Plant Sci, 2017. 8: p. 2125
    [PMID:29326737]