PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G71930.1
Common NameANAC030, F17M19.8, NAC030, VND7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 324aa    MW: 37426.6 Da    PI: 6.509
Description vascular related NAC-domain protein 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G71930.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.7e-5391371128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eelv +yL +k+++ k  l +vi e+d+yk+ePwd+++     ++e++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+vls 
  AT1G71930.1   9 MPPGFRFHPTEEELVGYYLDRKINSMKSAL-DVIVEIDLYKMEPWDIQArckLGYEEQNEWYFFSHKDRKYPTGTRTNRATAAGFWKATGRDKAVLS- 104
                  79*************************887.99**************953432233677**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  k++++g++ktLv+ykgrap+g+k+dW+mheyrl
  AT1G71930.1 105 KNSVIGMRKTLVYYKGRAPNGRKSDWIMHEYRL 137
                  8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-594158IPR003441NAC domain
PROSITE profilePS5100557.3349158IPR003441NAC domain
PfamPF023657.6E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0071555Biological Processcell wall organization
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000039anatomyshoot axis vascular system
PO:0000230anatomyinflorescence meristem
PO:0000272anatomyprotoxylem
PO:0003011anatomyroot vascular system
PO:0003015anatomyprimary root differentiation zone
PO:0005352anatomyxylem
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009046anatomyflower
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025257anatomyprimary root elongation zone
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDNIMQSSMP PGFRFHPTEE ELVGYYLDRK INSMKSALDV IVEIDLYKME PWDIQARCKL  60
GYEEQNEWYF FSHKDRKYPT GTRTNRATAA GFWKATGRDK AVLSKNSVIG MRKTLVYYKG  120
RAPNGRKSDW IMHEYRLQNS ELAPVQEEGW VVCRAFRKPI PNQRPLGYEP WQNQLYHVES  180
SNNYSSSVTM NTSHHIGASS SSHNLNQMLM SNNHYNPNNT SSSMHQYGNI ELPQLDSPSL  240
SPSLGTNKDQ NESFEQEEEK SFNCVDWRTL DTLLETQVIH PHNPNILMFE TQSYNPAPSF  300
PSMHQSYNEV EANIHHSLGC FPDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-49215810165NAC domain-containing protein 19
4dul_A2e-49215810165NAC domain-containing protein 19
1ut7_B2e-49215810165NO APICAL MERISTEM PROTEIN
1ut7_A2e-49215810165NO APICAL MERISTEM PROTEIN
1ut4_B2e-49215810165NO APICAL MERISTEM PROTEIN
1ut4_A2e-49215810165NO APICAL MERISTEM PROTEIN
3swp_D3e-49215813168NAC domain-containing protein 19
3swp_C3e-49215813168NAC domain-containing protein 19
3swp_B3e-49215813168NAC domain-containing protein 19
3swp_A3e-49215813168NAC domain-containing protein 19
3swm_D3e-49215813168NAC domain-containing protein 19
3swm_C3e-49215813168NAC domain-containing protein 19
3swm_B3e-49215813168NAC domain-containing protein 19
3swm_A3e-49215813168NAC domain-containing protein 19
3ulx_A3e-4921588168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260173_at0.0
Expression AtlasAT1G71930-
AtGenExpressAT1G71930-
ATTED-IIAT1G71930-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Predominantly expressed in immature xylem vessels, only in some cells just beside xylem vessels. Also present in various vascular cells of older part of the roots, near the location of emergence of the lateral roots. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131}.
UniprotTISSUE SPECIFICITY: Expressed in developing protoxylems in roots and shoots (PubMed:16103214, PubMed:16581911, PubMed:17565617, PubMed:18952777). Detected in root protoxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls. Expressed in roots, hypocotyls, cotyledons and leaves (PubMed:18445131). Accumulates in the xylem but not in interfascicular fibers or pith cells in inflorescence stems. Present in developing vessels of the secondary xylem in roots undergoing secondary growth (PubMed:18952777). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC-domain transcription factor with transcriptional activation activity that is involved in xylem formation. Induces transdifferentiation of various cells into protoxylem vessel elements. Located in the nucleus. Expression induced in the presence of auxin, cytokinin and brassinosteroids.
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20488898, PubMed:22037706, PubMed:21284754). Involved in xylem formation in roots and shoots, especially regulating protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:16103214, PubMed:18445131, PubMed:20488898, PubMed:21498679, PubMed:21284754). Can activate the expression of several genes including XCP1, MYB46, NAC010/SND3, MYB103, MYB58, MYB63, MYB83, KNAT7, ASL19 and ASL20 (PubMed:17890373, PubMed:19088331, PubMed:18952777, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:21284754). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:21284754, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22037706}.; FUNCTION: Required for the soilborne fungal pathogen Verticillium longisporum-induced transdifferentiation of chloroplast-containing bundle sheath cells to functional xylem elements leading to stunted growth, vein clearing, and leaf chloroses, as well as xylem hyperplasia within the vasculature of leaves, hypocotyls, and roots due to reinitiation of cambial activity and transdifferentiation of xylem parenchyma cells. This developmental reprogramming mediates also an increased drought stress tolerance. {ECO:0000269|PubMed:23023171}.
Function -- GeneRIF ? help Back to Top
  1. transcription switch for plant metaxylem and protoxylem vessel formation.
    [PMID: 16103214]
  2. VASCULAR-RELATED NAC-DOMAIN PROTEIN6 (VND6) and VND7, which are transcription factors required for TE differentiation, determine ASL19 and ASL20 expression in immature tracheary elements (TEs).
    [PMID: 19088331]
  3. A glucocorticoid-mediated posttranslational induction system of VND6 and VND7, is reported.
    [PMID: 20488898]
  4. VND7 regulates patterns of secondary cell wall deposition in vascular vessels.
    [PMID: 21284754]
  5. Verticillium-infected Arabidopsis wild-type plants show higher drought stress tolerance compared with noninfected plants, whereas this effect is attenuated by suppression of VND7 activity.
    [PMID: 23023171]
  6. VND7 transcription is a regulatory target of multiple classes of transcription factors.
    [PMID: 25265867]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBM25378322Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G71930.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214, PubMed:22345435). Up-regulated in a feed-back loop by ASL20 (PubMed:19088331). Levels are monitored by proteasome-mediated degradation (PubMed:18445131). Repressed by WEE1 upon replication stress to prevent premature tracheary element differentiation (PubMed:21498679). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22345435, ECO:0000269|PubMed:23023171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G16490(A), AT1G28470(A), AT1G62990(A), AT1G79180(A), AT2G38080(A), AT5G12870(A), AT5G17420(A), AT5G56110(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, brassinosteroid, cytokinin
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9C8W9
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Defects in protoxylem vessel formation in seedling roots. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G71930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0264470.0BT026447.1 Arabidopsis thaliana At1g71930 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177338.10.0vascular related NAC-domain protein 7
SwissprotQ9C8W90.0NAC30_ARATH; NAC domain-containing protein 30
TrEMBLD7KZ010.0D7KZ01_ARALL; Putative uncharacterized protein
STRINGAT1G71930.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69502744
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kubo M, et al.
    Transcription switches for protoxylem and metaxylem vessel formation.
    Genes Dev., 2005. 19(16): p. 1855-60
    [PMID:16103214]
  4. Mitsuda N,Seki M,Shinozaki K,Ohme-Takagi M
    The NAC transcription factors NST1 and NST2 of Arabidopsis regulate secondary wall thickenings and are required for anther dehiscence.
    Plant Cell, 2005. 17(11): p. 2993-3006
    [PMID:16214898]
  5. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  6. Mace DL, et al.
    Quantification of transcription factor expression from Arabidopsis images.
    Bioinformatics, 2006. 22(14): p. e323-31
    [PMID:16873489]
  7. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  8. Yang C, et al.
    Arabidopsis MYB26/MALE STERILE35 regulates secondary thickening in the endothecium and is essential for anther dehiscence.
    Plant Cell, 2007. 19(2): p. 534-48
    [PMID:17329564]
  9. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  10. Zhong R,Richardson EA,Ye ZH
    The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.
    Plant Cell, 2007. 19(9): p. 2776-92
    [PMID:17890373]
  11. Yamaguchi M,Kubo M,Fukuda H,Demura T
    Vascular-related NAC-DOMAIN7 is involved in the differentiation of all types of xylem vessels in Arabidopsis roots and shoots.
    Plant J., 2008. 55(4): p. 652-64
    [PMID:18445131]
  12. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  13. Soyano T,Thitamadee S,Machida Y,Chua NH
    ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis.
    Plant Cell, 2008. 20(12): p. 3359-73
    [PMID:19088331]
  14. Zhou J,Lee C,Zhong R,Ye ZH
    MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.
    Plant Cell, 2009. 21(1): p. 248-66
    [PMID:19122102]
  15. McCarthy RL,Zhong R,Ye ZH
    MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell Physiol., 2009. 50(11): p. 1950-64
    [PMID:19808805]
  16. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]
  17. Yamaguchi M, et al.
    VASCULAR-RELATED NAC-DOMAIN6 and VASCULAR-RELATED NAC-DOMAIN7 effectively induce transdifferentiation into xylem vessel elements under control of an induction system.
    Plant Physiol., 2010. 153(3): p. 906-14
    [PMID:20488898]
  18. Zhong R,Lee C,Ye ZH
    Global analysis of direct targets of secondary wall NAC master switches in Arabidopsis.
    Mol Plant, 2010. 3(6): p. 1087-103
    [PMID:20935069]
  19. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  20. Yamaguchi M, et al.
    VASCULAR-RELATED NAC-DOMAIN7 directly regulates the expression of a broad range of genes for xylem vessel formation.
    Plant J., 2011. 66(4): p. 579-90
    [PMID:21284754]
  21. Cools T, et al.
    The Arabidopsis thaliana checkpoint kinase WEE1 protects against premature vascular differentiation during replication stress.
    Plant Cell, 2011. 23(4): p. 1435-48
    [PMID:21498679]
  22. Ohtani M, et al.
    A NAC domain protein family contributing to the regulation of wood formation in poplar.
    Plant J., 2011. 67(3): p. 499-512
    [PMID:21649762]
  23. McCarthy RL,Zhong R,Ye ZH
    Secondary wall NAC binding element (SNBE), a key cis-acting element required for target gene activation by secondary wall NAC master switches.
    Plant Signal Behav, 2011. 6(9): p. 1282-5
    [PMID:21847026]
  24. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  25. Yoshimoto K, et al.
    A chemical biology approach reveals an opposite action between thermospermine and auxin in xylem development in Arabidopsis thaliana.
    Plant Cell Physiol., 2012. 53(4): p. 635-45
    [PMID:22345435]
  26. Reusche M, et al.
    Verticillium infection triggers VASCULAR-RELATED NAC DOMAIN7-dependent de novo xylem formation and enhances drought tolerance in Arabidopsis.
    Plant Cell, 2012. 24(9): p. 3823-37
    [PMID:23023171]
  27. Petersen PD, et al.
    Engineering of plants with improved properties as biofuels feedstocks by vessel-specific complementation of xylan biosynthesis mutants.
    Biotechnol Biofuels, 2012. 5(1): p. 84
    [PMID:23181474]
  28. Endo H, et al.
    Multiple classes of transcription factors regulate the expression of VASCULAR-RELATED NAC-DOMAIN7, a master switch of xylem vessel differentiation.
    Plant Cell Physiol., 2015. 56(2): p. 242-54
    [PMID:25265867]
  29. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]