PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G71692.1
Common NameAGL12, F14O23.5, F26A9.6, XAL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 23918.7 Da    PI: 7.3431
Description AGAMOUS-like 12
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G71692.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.23.4e-26957149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 krien   rqvtf+kRr+g+lKKA+ELSvLCdae+ v+ifs++gkl+e 
  AT1G71692.1  9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFEL 57
                 79********************************************996 PP

2K-box58.13.8e-209918118100
        K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                  + e++ Lk+eie+Lq+ +  + G + + ++l+eL  Le++Le  +++iRs K++++l++i+ l++ke  l+++nk+L +k+ee
  AT1G71692.1  99 KDEINVLKQEIEMLQKGISYMFGGGDGAMNLEELLLLEKHLEYWISQIRSAKMDVMLQEIQSLRNKEGVLKNTNKYLLEKIEE 181
                  6799****************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.885161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-29176IPR002100Transcription factor, MADS-box
SMARTSM004328.0E-37160IPR002100Transcription factor, MADS-box
CDDcd002652.50E-40278No hitNo description
PRINTSPR004041.7E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.7E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.56495185IPR002487Transcription factor, K-box
PfamPF014862.3E-1999179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0040008Biological Processregulation of growth
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000229anatomyflower meristem
PO:0000263anatomynon-hair root epidermal cell
PO:0003011anatomyroot vascular system
PO:0003015anatomyprimary root differentiation zone
PO:0005017anatomyflower vascular system
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009031anatomysepal
PO:0020100anatomyhypocotyl
PO:0020124anatomyroot stele
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MARGKIQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD AEIGVVIFSP QGKLFELATK  60
GTMEGMIDKY MKCTGGGRGS SSATFTAQEQ LQPPNLDPKD EINVLKQEIE MLQKGISYMF  120
GGGDGAMNLE ELLLLEKHLE YWISQIRSAK MDVMLQEIQS LRNKEGVLKN TNKYLLEKIE  180
ENNNSILDAN FAVMETNYSY PLTMPSEIFQ F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-16170169MEF2C
5f28_B3e-16170169MEF2C
5f28_C3e-16170169MEF2C
5f28_D3e-16170169MEF2C
6byy_A4e-16170169MEF2 CHIMERA
6byy_B4e-16170169MEF2 CHIMERA
6byy_C4e-16170169MEF2 CHIMERA
6byy_D4e-16170169MEF2 CHIMERA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.197190.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261504_at0.0
Expression AtlasAT1G71692-
AtGenExpressAT1G71692-
ATTED-IIAT1G71692-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269|PubMed:11855641}.
UniprotTISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269|PubMed:11855641, ECO:0000269|PubMed:18203871, ECO:0000269|PubMed:7549482}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the MADS box family of transcription factors. Involved in root cell differentiation and flowering time. Loss of function mutations have abnormal cellular differentiation in the roots and are late flowering. AGL12 along with AGL14, and AGL17 is preferentially expressed in root tissues and represent the only characterized MADS box genes expressed in roots.
UniProtProbable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}.
Function -- GeneRIF ? help Back to Top
  1. Three mutant alleles all have a short-root phenotype with a smaller meristem, lower rate of cell production, and abnormal root apical meristem organization.
    [PMID: 18203871]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G71692.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G65480(A), AT2G45660(A), AT5G61850(A)
Interaction ? help Back to Top
Source Intact With
IntActSearch Q38841
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Retarded root growth, and altered root meristem size and stem-cell patterning. Late flowering phenotype. {ECO:0000269|PubMed:18203871}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G71692
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2281900.0AK228190.1 Arabidopsis thaliana mRNA for MADS-box protein AGL12, complete cds, clone: RAFL14-63-K22.
GenBankBT0061570.0BT006157.1 Arabidopsis thaliana clone RAFL17-04-C08 (R50439) putative MADS-box protein (At1g71692) mRNA, complete cds.
GenBankBT0083320.0BT008332.1 Arabidopsis thaliana At1g71692 gene, complete cds.
GenBankBT0085240.0BT008524.1 Arabidopsis thaliana clone U50439 putative MADS-box protein (At1g71692) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565022.11e-156AGAMOUS-like 12
SwissprotQ388411e-157AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A178W2491e-154A0A178W249_ARATH; XAL1
STRINGAT1G71692.11e-155(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70522641
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Burgeff C,Liljegren SJ,Tapia-L
    MADS-box gene expression in lateral primordia, meristems and differentiated tissues of Arabidopsis thaliana roots.
    Planta, 2002. 214(3): p. 365-72
    [PMID:11855641]
  3. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Becker A,Theissen G
    The major clades of MADS-box genes and their role in the development and evolution of flowering plants.
    Mol. Phylogenet. Evol., 2003. 29(3): p. 464-89
    [PMID:14615187]
  7. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  8. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  9. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  10. Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG
    Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana.
    Planta, 2005. 222(4): p. 730-42
    [PMID:16021502]
  11. Mace DL, et al.
    Quantification of transcription factor expression from Arabidopsis images.
    Bioinformatics, 2006. 22(14): p. e323-31
    [PMID:16873489]
  12. Montiel G, et al.
    Transcription factor Agamous-like 12 from Arabidopsis promotes tissue-like organization and alkaloid biosynthesis in Catharanthus roseus suspension cells.
    Metab. Eng., 2007. 9(2): p. 125-32
    [PMID:17157545]
  13. Tapia-López R, et al.
    An AGAMOUS-related MADS-box gene, XAL1 (AGL12), regulates root meristem cell proliferation and flowering transition in Arabidopsis.
    Plant Physiol., 2008. 146(3): p. 1182-92
    [PMID:18203871]
  14. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  15. Pacheco-Escobedo MA, et al.
    Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm.
    Ann. Bot., 2018.
    [PMID:27358290]
  16. García-Cruz KV, et al.
    The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components.
    Ann. Bot., 2018.
    [PMID:27474508]
  17. Rounsley SD,Ditta GS,Yanofsky MF
    Diverse roles for MADS box genes in Arabidopsis development.
    Plant Cell, 1995. 7(8): p. 1259-69
    [PMID:7549482]