PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G70920.1
Common NameATHB18, ATHB-X, F15H11_25, HB18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 206aa    MW: 23519.5 Da    PI: 8.6637
Description homeobox-leucine zipper protein 18
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G70920.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.4e-1967122156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rrk+ ++tkeq + Lee F +n++++ +++++LA+ l+L++rqV vWFqNrRa+ k
  AT1G70920.1  67 RRKKLRLTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSK 122
                  79999*************************************************98 PP

2HD-ZIP_I/II109.91.8e-3568156190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  +kk+rl+keq++lLEesF ++++L+p++K++la+ L+l++rqv+vWFqnrRAR k+k++E+++e+Lkr++ +lke+n+rL+ eveeLr +
  AT1G70920.1  68 RKKLRLTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSKLKHTEMECEYLKRWFGSLKEQNRRLQIEVEELR-A 156
                  69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.36E-2053123IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-1856122IPR009057Homeodomain-like
PROSITE profilePS5007117.94564124IPR001356Homeobox domain
SMARTSM003892.2E-1766128IPR001356Homeobox domain
PfamPF000461.8E-1667122IPR001356Homeobox domain
CDDcd000868.25E-1667125No hitNo description
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
SMARTSM003402.9E-16124167IPR003106Leucine zipper, homeobox-associated
PfamPF021832.9E-9124158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MALSPNSSSL DLTISIPSFS PSPSLGDHHG MRDFDINQTP KTEEDREWMI GATPHVNEDD  60
SNSGGRRRKK LRLTKEQSHL LEESFIQNHT LTPKQKKDLA TFLKLSQRQV EVWFQNRRAR  120
SKLKHTEMEC EYLKRWFGSL KEQNRRLQIE VEELRALKPS STSALTMCPR CERVTDAVDN  180
DSNAVQEGAV LSSRSRMTIS SSSSLC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16472GRRRKKLRL
26571RRRKKLR
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864945120.0
Genevisible262311_at1e-126
Expression AtlasAT1G70920-
AtGenExpressAT1G70920-
ATTED-IIAT1G70920-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. role in male gametophyte development
    [PMID: 27896439]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00226DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G70920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G70920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1758370.0AK175837.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-44-P21.
GenBankAK1759650.0AK175965.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-65-O17.
GenBankEU3391860.0EU339186.1 Arabidopsis thaliana HD-ZIP transcription factor 18 (ATHB18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177248.31e-152homeobox-leucine zipper protein 18
SwissprotQ8GXM71e-153ATHBX_ARATH; Homeobox-leucine zipper protein ATHB-X
TrEMBLA9Z1E81e-151A9Z1E8_ARATH; HD-ZIP transcription factor 18
STRINGAT1G70920.11e-151(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133801624
Representative plantOGRP19616156
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  5. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  6. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]