PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G70000.2
Common NameF20P5.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 261aa    MW: 28793.1 Da    PI: 10.5791
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G70000.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-1499143347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
      AT1G70000.2  99 PWTEEEHRLFLTGLHKVGKGDWRGISRNFVKTRTPTQVASHAQKY 143
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501589.125519IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.27892148IPR017930Myb domain
SuperFamilySSF466896.63E-1794148IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-1695146IPR006447Myb domain, plants
SMARTSM007172.3E-1196146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-1198143IPR009057Homeodomain-like
CDDcd001672.39E-1099144No hitNo description
PfamPF002497.0E-1299143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MSRSCSQCGN NGHNSRTCPT DITTTGDNND KGGGEKAIML FGVRVTEASS SCFRKSVSMN  60
NLSQFDQTPD PNPTDDGGYA SDDVVHASGR NRERKRGTPW TEEEHRLFLT GLHKVGKGDW  120
RGISRNFVKT RTPTQVASHA QKYFLRRTNQ NRRRRRSSLF DITPDSFIGS SKEENQLQTP  180
LELIRPVPIP IPIPPSRKMA DLNLNKKKTP ATTEMFPLSL NLQRPSSSTS SSSNEQKARG  240
SRASSGFEAM SSNGDSIMGV A
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.353540.0root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264692_at0.0
Expression AtlasAT1G70000-
AtGenExpressAT1G70000-
ATTED-IIAT1G70000-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G70000.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G70000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0064130.0BT006413.1 Arabidopsis thaliana At1g70000 gene, complete cds.
GenBankAY5195090.0AY519509.1 Arabidopsis thaliana MYB transcription factor (At1g70000) mRNA, complete cds.
GenBankAK2277110.0AK227711.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-29-L19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001185359.10.0myb-like transcription factor
RefseqNP_177158.10.0myb-like transcription factor
SwissprotQ2V9B04e-45MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLO045440.0O04544_ARATH; At1g70000
STRINGAT1G70000.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  5. Nelson DC, et al.
    Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100
    [PMID:20351290]
  6. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  7. Nguyen NH, et al.
    MYBD employed by HY5 increases anthocyanin accumulation via repression of MYBL2 in Arabidopsis.
    Plant J., 2015. 84(6): p. 1192-205
    [PMID:26576746]