PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G69780.1
Common NameATHB13, ATHB-13, T6C23.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 294aa    MW: 33342 Da    PI: 5.4002
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G69780.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.7e-1885138356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  AT1G69780.1  85 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 138
                  456899***********************************************9 PP

2HD-ZIP_I/II131.72.8e-4284175192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lkr++d+lk+en+ L++++++L++e++
  AT1G69780.1  84 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDTLKRQFDTLKAENDLLQTHNQKLQAEIM 175
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.55E-1974142IPR009057Homeodomain-like
PROSITE profilePS5007117.21680140IPR001356Homeobox domain
SMARTSM003891.8E-1783144IPR001356Homeobox domain
CDDcd000862.44E-1685141No hitNo description
PfamPF000463.0E-1585138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.9E-1987147IPR009057Homeodomain-like
PRINTSPR000311.2E-5111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5120136IPR000047Helix-turn-helix motif
CDDcd146860.00818133174No hitNo description
PfamPF021834.7E-16140181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSCNNGMSFF PSNFMIQTSY EDDHPHQSPS LAPLLPSCSL PQDLHGFASF LGKRSPMEGC  60
CDLETGNNMN GEEDYSDDGS QMGEKKRRLN MEQVKTLEKN FELGNKLEPE RKMQLARALG  120
LQPRQIAIWF QNRRARWKTK QLEKDYDTLK RQFDTLKAEN DLLQTHNQKL QAEIMGLKNR  180
EQTESINLNK ETEGSCSNRS DNSSDNLRLD ISTAPPSNDS TLTGGHPPPP QTVGRHFFPP  240
SPATATTTTT TMQFFQNSSS GQSMVKEENS ISNMFCAMDD HSGFWPWLDQ QQYN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.237360.0bud| floral meristem| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO66442940.0
Genevisible260395_at0.0
Expression AtlasAT1G69780-
AtGenExpressAT1G69780-
ATTED-IIAT1G69780-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in leaves and flowers. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) protein.
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Function -- GeneRIF ? help Back to Top
  1. AtHB13 is involved in plant cold tolerance via the induction of proteins able to stabilize cell membranes and inhibit ice growth.
    [PMID: 21899607]
  2. The expression of AtHB13 is up-regulated by drought and salinity stresses. [AtHB13]
    [PMID: 22564282]
  3. ATHB13 is involved in the crosstalk between abiotic and biotic stress resistance pathways.
    [PMID: 25293871]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G69780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G69780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2080440.0AF208044.1 Arabidopsis thaliana homeodomain leucine-zipper protein ATHB13 mRNA, complete cds.
GenBankAY0575720.0AY057572.1 Arabidopsis thaliana At1g69780/T6C23_2 mRNA, complete cds.
GenBankAY1336450.0AY133645.1 Arabidopsis thaliana At1g69780/T6C23_2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177136.10.0Homeobox-leucine zipper protein family
SwissprotQ8LC030.0ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A178WPS40.0A0A178WPS4_ARATH; ATHB13
STRINGAT1G69780.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26332770
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Johannesson H,Wang Y,Engström P
    DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro.
    Plant Mol. Biol., 2001. 45(1): p. 63-73
    [PMID:11247607]
  3. Hanson J,Johannesson H,Engström P
    Sugar-dependent alterations in cotyledon and leaf development in transgenic plants expressing the HDZhdip gene ATHB13.
    Plant Mol. Biol., 2001. 45(3): p. 247-62
    [PMID:11292072]
  4. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Menges M,Hennig L,Gruissem W,Murray JA
    Genome-wide gene expression in an Arabidopsis cell suspension.
    Plant Mol. Biol., 2003. 53(4): p. 423-42
    [PMID:15010610]
  7. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  8. Cabello JV,Arce AL,Chan RL
    The homologous HD-Zip I transcription factors HaHB1 and AtHB13 confer cold tolerance via the induction of pathogenesis-related and glucanase proteins.
    Plant J., 2012. 69(1): p. 141-53
    [PMID:21899607]
  9. Cabello JV,Chan RL
    The homologous homeodomain-leucine zipper transcription factors HaHB1 and AtHB13 confer tolerance to drought and salinity stresses via the induction of proteins that stabilize membranes.
    Plant Biotechnol. J., 2012. 10(7): p. 815-25
    [PMID:22564282]
  10. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  11. Capella M,R
    Plant homeodomain-leucine zipper I transcription factors exhibit different functional AHA motifs that selectively interact with TBP or/and TFIIB.
    Plant Cell Rep., 2014. 33(6): p. 955-67
    [PMID:24531799]
  12. Gao D, et al.
    Activation tagging of ATHB13 in Arabidopsis thaliana confers broad-spectrum disease resistance.
    Plant Mol. Biol., 2014. 86(6): p. 641-53
    [PMID:25293871]
  13. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  14. Silva AT,Ribone PA,Chan RL,Ligterink W,Hilhorst HW
    A Predictive Coexpression Network Identifies Novel Genes Controlling the Seed-to-Seedling Phase Transition in Arabidopsis thaliana.
    Plant Physiol., 2016. 170(4): p. 2218-31
    [PMID:26888061]
  15. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  16. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]