PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G69570.1
Common NameCDF5, DOF1.10, F10D13.20, F24J1.25, HPPBF-2B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 399aa    MW: 44006.6 Da    PI: 8.8242
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G69570.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1222.1e-38128187261
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                  ++k ++cprC+s+ntkfCyynny+++qPryfC++C+ryWt+GG++rnvPvG+grrknk +
  AT1G69570.1 128 PDKLIPCPRCESANTKFCYYNNYNVNQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKNKGW 187
                  78999****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-31125185IPR003851Zinc finger, Dof-type
PfamPF027012.3E-31130185IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.379132186IPR003851Zinc finger, Dof-type
PROSITE patternPS013610134170IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MSKSRDTEIK LFGRTITSLL DVNCYDPSSL SPVHDVSSDP SKEDSSSSSS SCSPTIGPIR  60
VPVKKSEQES NKFKDPYILS DLNEPPKAVS EISSPRSSKN NCDQQSEITT TTTTSTTSGE  120
KSTALKKPDK LIPCPRCESA NTKFCYYNNY NVNQPRYFCR NCQRYWTAGG SMRNVPVGSG  180
RRKNKGWPSS NHYLQVTSED CDNNNSGTIL SFGSSESSVT ETGKHQSGDT AKISADSVSQ  240
ENKSYQGFLP PQVMLPNNSS PWPYQWSPTG PNASFYPVPF YWGCTVPIYP TSETSSCLGK  300
RSRDQTEGRI NDTNTTITTT RARLVSESLR MNIEASKSAV WSKLPTKPEK KTQGFSLFNG  360
FDTKGNSNRS SLVSETSHSL QANPAAMSRA MNFRESMQQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.107320.0flower| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453373370.0
Genevisible259834_at0.0
Expression AtlasAT1G69570-
AtGenExpressAT1G69570-
ATTED-IIAT1G69570-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Function -- GeneRIF ? help Back to Top
  1. CDF5/FLORE NAT pair constitutes an additional circadian regulatory module with conserved (mutual inhibition) and unique (function in trans) features, able to fine-tune its own circadian oscillation, and consequently, adjust the onset of flowering to favourable environmental conditions. [CDF5]
    [PMID: 28758689]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00223DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G69570.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Early flowering. {ECO:0000269|PubMed:19619493}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G69570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1763460.0AK176346.1 Arabidopsis thaliana mRNA for putative H-protein promoter binding factor-2b, complete cds, clone: RAFL24-04-C08.
GenBankBT0256230.0BT025623.1 Arabidopsis thaliana At1g69570 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177116.10.0Dof-type zinc finger DNA-binding family protein
SwissprotQ9SEZ30.0CDF5_ARATH; Cyclic dof factor 5
TrEMBLA0A178WAR40.0A0A178WAR4_ARATH; Uncharacterized protein
STRINGAT1G69570.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130901729
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  4. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  5. Rohde A, et al.
    Molecular phenotyping of the pal1 and pal2 mutants of Arabidopsis thaliana reveals far-reaching consequences on phenylpropanoid, amino acid, and carbohydrate metabolism.
    Plant Cell, 2004. 16(10): p. 2749-71
    [PMID:15377757]
  6. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  7. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]
  8. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  9. Chawade A,Br
    Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors.
    BMC Genomics, 2007. 8: p. 304
    [PMID:17764576]
  10. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  11. Fornara F, et al.
    Arabidopsis DOF transcription factors act redundantly to reduce CONSTANS expression and are essential for a photoperiodic flowering response.
    Dev. Cell, 2009. 17(1): p. 75-86
    [PMID:19619493]
  12. Licausi F, et al.
    Hypoxia responsive gene expression is mediated by various subsets of transcription factors and miRNAs that are determined by the actual oxygen availability.
    New Phytol., 2011. 190(2): p. 442-56
    [PMID:20840511]
  13. Henriques R, et al.
    The antiphasic regulatory module comprising CDF5 and its antisense RNA FLORE links the circadian clock to photoperiodic flowering.
    New Phytol., 2017. 216(3): p. 854-867
    [PMID:28758689]
  14. Martín G, et al.
    Circadian Waves of Transcriptional Repression Shape PIF-Regulated Photoperiod-Responsive Growth in Arabidopsis.
    Curr. Biol., 2018. 28(2): p. 311-318.e5
    [PMID:29337078]