PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G69540.1
Common NameAGL94
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 344aa    MW: 39220.8 Da    PI: 7.1648
Description AGAMOUS-like 94
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G69540.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.91.7e-201153345
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  +n   rq t++kRr+gi+KKA+ELS+LCd++v +++fs+ gk
  AT1G69540.1 11 LQNMNGRQCTYTKRRHGIMKKAKELSILCDIDVVLLMFSPMGK 53
                 568888**********************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-27160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.058153IPR002100Transcription factor, MADS-box
CDDcd002664.30E-22281No hitNo description
SuperFamilySSF554556.02E-24293IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-16323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-161253IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRVKLKIKK LQNMNGRQCT YTKRRHGIMK KAKELSILCD IDVVLLMFSP MGKASICIGK  60
HSIGEVIAKF AQLSPQERAK RKLENLEALR KTFMKANHDI DISKFLDRIS TPTVEVLSEK  120
IRFLQTQLSD IHTRLSYWTD VDNIDSVDVL QQLEHSLRQS LAQIYGRKAS MPQRQQQQLM  180
SSQCKNQLQT EIDIDFGMEM EQQLENFSWV RTDENMNVPI EEEDPNLQLH HMYKDITCSA  240
SSALGNYSGL FSKSSDILQK LETGSIPGTS ADPNQQFSNL SFLNDQKLKQ LAEWNLLGSP  300
ADYYVSQILE ASYKPQIGGK NNGASSETLP YVAVFDDPLY FWPN
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864941480.0
Genevisible256298_at9e-77
Expression AtlasAT1G69540-
AtGenExpressAT1G69540-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the MIKC (MADS box, Keratin binding domain, and C terminal domain containing )family of transcriptional regulators.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G69540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G69540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1150130.0AB115013.1 Arabidopsis thaliana At1g69540 mRNA for MADS-box protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177113.30.0AGAMOUS-like 94
TrEMBLQ766C00.0Q766C0_ARATH; AGAMOUS-like 94
STRINGAT1G69540.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149561620
Representative plantOGRP59461119
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  7. Verelst W,Saedler H,M√ľnster T
    MIKC* MADS-protein complexes bind motifs enriched in the proximal region of late pollen-specific Arabidopsis promoters.
    Plant Physiol., 2007. 143(1): p. 447-60
    [PMID:17071640]
  8. Adamczyk BJ,Fernandez DE
    MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.
    Plant Physiol., 2009. 149(4): p. 1713-23
    [PMID:19211705]