PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G69490.1
Common NameANAC029, ATNAP, F10D13.14, NAC029, NAC29, NAP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 268aa    MW: 31425.7 Da    PI: 6.8608
Description NAC-like, activated by AP3/PI
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G69490.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.62.9e-5491341128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+v+yL++++ +k++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfFs+r++ky++g r+nra+ sgyWkatg+dk+++s +++
  AT1G69490.1   9 LPPGFRFHPTDEELIVYYLRNQTMSKPCPV-SIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHS-GSS 104
                  79****************************.89***************99999*****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +vg+kk Lvfykgr pkg ktdW+mheyrl
  AT1G69490.1 105 NVGVKKALVFYKGRPPKGIKTDWIMHEYRL 134
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-654161IPR003441NAC domain
PROSITE profilePS5100560.6119161IPR003441NAC domain
PfamPF023651.0E-2610134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0006081anatomyprimary root apical meristem
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020124anatomyroot stele
PO:0020149anatomyquiescent center
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001026developmental stageD locules established stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEVTSQSTLP PGFRFHPTDE ELIVYYLRNQ TMSKPCPVSI IPEVDIYKFD PWQLPEKTEF  60
GENEWYFFSP RERKYPNGVR PNRAAVSGYW KATGTDKAIH SGSSNVGVKK ALVFYKGRPP  120
KGIKTDWIMH EYRLHDSRKA STKRNGSMRL DEWVLCRIYK KRGASKLLNE QEGFMDEVLM  180
EDETKVVVNE AERRTEEEIM MMTSMKLPRT CSLAHLLEMD YMGPVSHIDN FSQFDHLHQP  240
DSESSWFGDL QFNQDEILNH HRQAMFKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-71516613170NO APICAL MERISTEM PROTEIN
1ut4_B1e-71516613170NO APICAL MERISTEM PROTEIN
1ut7_A1e-71516613170NO APICAL MERISTEM PROTEIN
1ut7_B1e-71516613170NO APICAL MERISTEM PROTEIN
3swm_A1e-71516616173NAC domain-containing protein 19
3swm_B1e-71516616173NAC domain-containing protein 19
3swm_C1e-71516616173NAC domain-containing protein 19
3swm_D1e-71516616173NAC domain-containing protein 19
3swp_A1e-71516616173NAC domain-containing protein 19
3swp_B1e-71516616173NAC domain-containing protein 19
3swp_C1e-71516616173NAC domain-containing protein 19
3swp_D1e-71516616173NAC domain-containing protein 19
4dul_A1e-71516613170NAC domain-containing protein 19
4dul_B1e-71516613170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.249190.0floral meristem| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO134305770.0
Genevisible256300_at0.0
Expression AtlasAT1G69490-
AtGenExpressAT1G69490-
ATTED-IIAT1G69490-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:9489703}.
UniprotTISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269|PubMed:16640597}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the NAC transcription factor gene family. It is expressed in floral primordia and upregulated by AP3 and PI. Its expression is associated with leaf senescence.
UniProtTranscription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion. {ECO:0000269|PubMed:16640597}.
Function -- GeneRIF ? help Back to Top
  1. Expression of AtNAP is closely associated with the senescence process of Arabidopsis rosette leaves.
    [PMID: 16640597]
  2. Arabidopsis silique senescence is highly controlled by AtNAP. Silique senescence is delayed and the respiration surge associated with endogenous or exogenous ethylene is suppressed in the atnap knockout mutant plants.
    [PMID: 23066145]
  3. NAP promotes chlorophyll degradation by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone ABA.
    [PMID: 25516602]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G69490.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI). {ECO:0000269|PubMed:9489703}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G54340 (A), AT5G20240 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G47340(A), AT5G15970(R), AT5G52310(R)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype, but delayed leaf senescence. {ECO:0000269|PubMed:16640597}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G69490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0510150.0AY051015.1 Arabidopsis thaliana unknown protein (At1g69490) mRNA, complete cds.
GenBankAF3602010.0AF360201.1 Arabidopsis thaliana unknown protein (At1g69490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564966.10.0NAC transcription factor protein family
SwissprotO492550.0NAC29_ARATH; NAC transcription factor 29
TrEMBLD7KX200.0D7KX20_ARALL; NAC domain protein NAC2
STRINGAT1G69490.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM77072641
Publications ? help Back to Top
  1. Kikuchi K, et al.
    Molecular analysis of the NAC gene family in rice.
    Mol. Gen. Genet., 2000. 262(6): p. 1047-51
    [PMID:10660065]
  2. Ren T,Qu F,Morris TJ
    HRT gene function requires interaction between a NAC protein and viral capsid protein to confer resistance to turnip crinkle virus.
    Plant Cell, 2000. 12(10): p. 1917-26
    [PMID:11041886]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Wu Y, et al.
    The abi1-1 mutation blocks ABA signaling downstream of cADPR action.
    Plant J., 2003. 34(3): p. 307-15
    [PMID:12713537]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  7. Nawy T, et al.
    Transcriptional profile of the Arabidopsis root quiescent center.
    Plant Cell, 2005. 17(7): p. 1908-25
    [PMID:15937229]
  8. Guo Y,Gan S
    AtNAP, a NAC family transcription factor, has an important role in leaf senescence.
    Plant J., 2006. 46(4): p. 601-12
    [PMID:16640597]
  9. Hurtado L,Farrona S,Reyes JC
    The putative SWI/SNF complex subunit BRAHMA activates flower homeotic genes in Arabidopsis thaliana.
    Plant Mol. Biol., 2006. 62(1-2): p. 291-304
    [PMID:16845477]
  10. Bl
    Warm and cold parental reproductive environments affect seed properties, fitness, and cold responsiveness in Arabidopsis thaliana progenies.
    Plant Cell Environ., 2007. 30(2): p. 165-75
    [PMID:17238908]
  11. Mara CD,Irish VF
    Two GATA transcription factors are downstream effectors of floral homeotic gene action in Arabidopsis.
    Plant Physiol., 2008. 147(2): p. 707-18
    [PMID:18417639]
  12. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  13. Kunieda T, et al.
    NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2631-42
    [PMID:18849494]
  14. Katari MS, et al.
    VirtualPlant: a software platform to support systems biology research.
    Plant Physiol., 2010. 152(2): p. 500-15
    [PMID:20007449]
  15. Abdeen A,Schnell J,Miki B
    Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3.
    BMC Genomics, 2010. 11: p. 69
    [PMID:20105335]
  16. Vogelmann K, et al.
    Early senescence and cell death in Arabidopsis saul1 mutants involves the PAD4-dependent salicylic acid pathway.
    Plant Physiol., 2012. 159(4): p. 1477-87
    [PMID:22706448]
  17. Kou X,Watkins CB,Gan SS
    Arabidopsis AtNAP regulates fruit senescence.
    J. Exp. Bot., 2012. 63(17): p. 6139-47
    [PMID:23066145]
  18. Li DM,Wang JH,Peng SL,Zhu GF,L
    Molecular cloning and characterization of two novel NAC genes from Mikania micrantha (Asteraceae).
    Genet. Mol. Res., 2012. 11(4): p. 4383-401
    [PMID:23079980]
  19. Kim HJ, et al.
    Gene regulatory cascade of senescence-associated NAC transcription factors activated by ETHYLENE-INSENSITIVE2-mediated leaf senescence signalling in Arabidopsis.
    J. Exp. Bot., 2014. 65(14): p. 4023-36
    [PMID:24659488]
  20. Yang J,Worley E,Udvardi M
    A NAP-AAO3 regulatory module promotes chlorophyll degradation via ABA biosynthesis in Arabidopsis leaves.
    Plant Cell, 2014. 26(12): p. 4862-74
    [PMID:25516602]
  21. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  22. Huang D, et al.
    A Gibberellin-Mediated DELLA-NAC Signaling Cascade Regulates Cellulose Synthesis in Rice.
    Plant Cell, 2015. 27(6): p. 1681-96
    [PMID:26002868]
  23. Sablowski RW,Meyerowitz EM
    A homolog of NO APICAL MERISTEM is an immediate target of the floral homeotic genes APETALA3/PISTILLATA.
    Cell, 1998. 92(1): p. 93-103
    [PMID:9489703]