PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G69310.2
Common NameATWRKY57, F10D13.1, F23O10.11, WRKY57
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 287aa    MW: 32042.1 Da    PI: 6.7027
Description WRKY DNA-binding protein 57
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G69310.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.23.5e-33147204259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp++v++tYeg+H h+
  AT1G69310.2 147 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSRCTVKKRVERSSDDPSIVITTYEGQHCHQ 204
                  8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-34131205IPR003657WRKY domain
SuperFamilySSF1182901.57E-28138204IPR003657WRKY domain
PROSITE profilePS5081129.838141206IPR003657WRKY domain
SMARTSM007746.8E-39146205IPR003657WRKY domain
PfamPF031062.5E-26147204IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MNDPDNPDLS NDDSAWRELT LTAQDSDFFD RDTSNILSDF GWNLHHSSDH PHSLRFDSDL  60
TQTTGVKPTT VTSSCSSSAA VSVAVTSTNN NPSATSSSSE DPAENSTASA EKTPPPETPV  120
KEKKKAQKRI RQPRFAFMTK SDVDNLEDGY RWRKYGQKAV KNSPFPRSYY RCTNSRCTVK  180
KRVERSSDDP SIVITTYEGQ HCHQTIGFPR GGILTAHDPH SFTSHHHLPP PLPNPYYYQE  240
LLHQLHRDNN APSPRLPRPT TEDTPAVSTP SEEGLLGDIV PQTMRNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-25136203774Probable WRKY transcription factor 4
1wj2_A2e-25136203774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260337_at0.0
Expression AtlasAT1G69310-
AtGenExpressAT1G69310-
ATTED-IIAT1G69310-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. the functions of WRKY57
    [PMID: 22930734]
  2. JA-induced leaf senescence process can be antagonized by auxin via WRKY57.
    [PMID: 24424094]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G69310.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G69310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0260570.0BT026057.1 Arabidopsis thaliana At1g69310 mRNA, complete cds.
GenBankAY0718490.0AY071849.1 Arabidopsis thaliana WRKY transcription factor 57 (WRKY57) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177090.10.0putative WRKY transcription factor 57
RefseqNP_974112.10.0putative WRKY transcription factor 57
SwissprotQ9C9830.0WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLQ147N60.0Q147N6_ARATH; At1g69310
STRINGAT1G69310.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Brodersen P, et al.
    Arabidopsis MAP kinase 4 regulates salicylic acid- and jasmonic acid/ethylene-dependent responses via EDS1 and PAD4.
    Plant J., 2006. 47(4): p. 532-46
    [PMID:16813576]
  4. Jiang Y,Liang G,Yu D
    Activated expression of WRKY57 confers drought tolerance in Arabidopsis.
    Mol Plant, 2012. 5(6): p. 1375-88
    [PMID:22930734]
  5. Jiang Y,Liang G,Yang S,Yu D
    Arabidopsis WRKY57 functions as a node of convergence for jasmonic acid- and auxin-mediated signaling in jasmonic acid-induced leaf senescence.
    Plant Cell, 2014. 26(1): p. 230-45
    [PMID:24424094]