PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G69170.1
Common NameAtSPL6, F23O10.24, F4N2.13, SPL6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 405aa    MW: 45952.8 Da    PI: 7.7384
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G69170.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.53.4e-42124199277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dls+ k+yh+rh+vCe+hsk++vv+v+gleqrfCqqCsrfh lsefD++krsCrrrLa+hnerrrk++
  AT1G69170.1 124 CQVYGCSKDLSSSKDYHKRHRVCEAHSKTSVVIVNGLEQRFCQQCSRFHFLSEFDDGKRSCRRRLAGHNERRRKPA 199
                  **************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-33119185IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.872121198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-39122201IPR004333Transcription factor, SBP-box
PfamPF031106.3E-32124197IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MDSWSYGRSV FMSNETLLPC DTFAKNRRFE QRLSNNDDVL ISDMAGNSNG FSAVSITKVV  60
PEEEDEENIS SSSKFSSQEL NRIDFKLRSF LDLGNDDDDT SSRGFALPSK KSRASNLCSQ  120
NPLCQVYGCS KDLSSSKDYH KRHRVCEAHS KTSVVIVNGL EQRFCQQCSR FHFLSEFDDG  180
KRSCRRRLAG HNERRRKPAF YFLPGKRHKL LRTSQDVVGN KFLENSSLVL PESFPGSLLY  240
RVIDEDDHRT SRLVSFKDEP TCSMFPTNEQ NSSRTYESKP AIYSTEVSSI WDLHETAASR  300
STRALSLLSA QSQQHLSKFP NTTFSITQPN QNLNHSSSTD YHQMEQPLWI DPGKTNSAGS  360
SSCKGKGTST VDLLQLSSHL QRIEQQRNYT GDVKQEYNEL YFPGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-311231971084squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.5000.0cell culture| root| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453373110.0
Genevisible260341_at0.0
Expression AtlasAT1G69170-
AtGenExpressAT1G69170-
ATTED-IIAT1G69170-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively during plant development, weak increase during flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G69170.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q94JW8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G69170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0064360.0BT006436.1 Arabidopsis thaliana At1g69170 gene, complete cds.
GenBankAK2279640.0AK227964.1 Arabidopsis thaliana mRNA for squamosa promoter binding protein-like 6, complete cds, clone: RAFL14-51-E10.
GenBankAJ0116430.0AJ011643.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177077.30.0squamosa promoter-binding-like protein 6
SwissprotQ94JW80.0SPL6_ARATH; Squamosa promoter-binding-like protein 6
TrEMBLD7KWY90.0D7KWY9_ARALL; Putative uncharacterized protein
STRINGAT1G69170.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MalvidsOGEM92752435
Publications ? help Back to Top
  1. Cardon G, et al.
    Molecular characterisation of the Arabidopsis SBP-box genes.
    Gene, 1999. 237(1): p. 91-104
    [PMID:10524240]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Rhoades MW, et al.
    Prediction of plant microRNA targets.
    Cell, 2002. 110(4): p. 513-20
    [PMID:12202040]
  4. Schmid M, et al.
    Dissection of floral induction pathways using global expression analysis.
    Development, 2003. 130(24): p. 6001-12
    [PMID:14573523]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Yoo BC, et al.
    A systemic small RNA signaling system in plants.
    Plant Cell, 2004. 16(8): p. 1979-2000
    [PMID:15258266]
  7. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  8. Padmanabhan MS, et al.
    Novel positive regulatory role for the SPL6 transcription factor in the N TIR-NB-LRR receptor-mediated plant innate immunity.
    PLoS Pathog., 2013. 9(3): p. e1003235
    [PMID:23516366]
  9. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]