PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G68880.1
Common NameAtbZIP, bZIP, BZIP8, F14K14.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 138aa    MW: 16245.4 Da    PI: 10.209
Description basic leucine-zipper 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G68880.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.27.6e-1347100558
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  ++ rrk +NRe+ArrsR RK+  +eeL     +L ++Nk+L +el++ ++ ++k
  AT1G68880.1  47 RKRRRKVSNRESARRSRMRKQRHMEELWSMLVQLINKNKSLVDELSQARECYEK 100
                  6789******************************************99998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-938100No hitNo description
SMARTSM003381.2E-1243107IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.47345108IPR004827Basic-leucine zipper domain
PfamPF001702.5E-1046100IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-114798No hitNo description
CDDcd147022.38E-144898No hitNo description
PROSITE patternPS0003605065IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0007115developmental stageLP.04 four leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MAGSVYNLPS QNPNPQSLFQ IFVDRVPLSN LPATSDDSSR TAEDNERKRR RKVSNRESAR  60
RSRMRKQRHM EELWSMLVQL INKNKSLVDE LSQARECYEK VIEENMKLRE ENSKSRKMIG  120
EIGLNRFLSV EADQIWTF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14650RKRRR
25966RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.265710.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260030_at0.0
Expression AtlasAT1G68880-
AtGenExpressAT1G68880-
ATTED-IIAT1G68880-
Function -- GeneRIF ? help Back to Top
  1. A more precise definition of the subcellular localization of HBZ, its interaction with cellular factors and an estimate of its amount in vivo both in HTLV-1 infected and in ATL tumor cells was studied.
    [PMID: 26140924]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G68880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G68880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0116650.0AC011665.8 Arabidopsis thaliana chromosome 1 BAC T6L1 genomic sequence, complete sequence.
GenBankAC0119140.0AC011914.9 Arabidopsis thaliana chromosome 1 BAC F14K14 genomic sequence, complete sequence.
GenBankAF4006210.0AF400621.1 Arabidopsis thaliana transcription factor-like protein bZIP8 mRNA, complete cds.
GenBankBT0248170.0BT024817.1 Arabidopsis thaliana At1g68880 gene, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177054.12e-97basic leucine-zipper 8
SwissprotQ9CA462e-98BZIP8_ARATH; Basic leucine zipper 8
TrEMBLA0A178WI503e-95A0A178WI50_ARATH; BZIP
STRINGAT1G68880.19e-97(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150351619
Representative plantOGRP31041129
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. William DA, et al.
    Genomic identification of direct target genes of LEAFY.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(6): p. 1775-80
    [PMID:14736918]
  5. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  6. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  7. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  8. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  9. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  10. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  11. Reeves WM,Lynch TJ,Mobin R,Finkelstein RR
    Direct targets of the transcription factors ABA-Insensitive(ABI)4 and ABI5 reveal synergistic action by ABI4 and several bZIP ABA response factors.
    Plant Mol. Biol., 2011. 75(4-5): p. 347-63
    [PMID:21243515]
  12. Agarwal P,Kapoor S,Tyagi AK
    Transcription factors regulating the progression of monocot and dicot seed development.
    Bioessays, 2011. 33(3): p. 189-202
    [PMID:21319185]
  13. Liu JZ, et al.
    Soybean homologs of MPK4 negatively regulate defense responses and positively regulate growth and development.
    Plant Physiol., 2011. 157(3): p. 1363-78
    [PMID:21878550]
  14. Zander M,Chen S,Imkampe J,Thurow C,Gatz C
    Repression of the Arabidopsis thaliana jasmonic acid/ethylene-induced defense pathway by TGA-interacting glutaredoxins depends on their C-terminal ALWL motif.
    Mol Plant, 2012. 5(4): p. 831-40
    [PMID:22207719]

  15. MEDIATOR25 acts as an integrative hub for the regulation of jasmonate-responsive gene expression in Arabidopsis.
    Plant Physiol., 2012. 160(1): p. 541-55
    [PMID:22822211]
  16. Chen D, et al.
    Antagonistic basic helix-loop-helix/bZIP transcription factors form transcriptional modules that integrate light and reactive oxygen species signaling in Arabidopsis.
    Plant Cell, 2013. 25(5): p. 1657-73
    [PMID:23645630]
  17. Raval GU, et al.
    Localization, quantification and interaction with host factors of endogenous HTLV-1 HBZ protein in infected cells and ATL.
    Retrovirology, 2015. 12: p. 59
    [PMID:26140924]
  18. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]