PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G68800.1
Common NameBRC2, F14K14.9, TCP12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TCP
Protein Properties Length: 356aa    MW: 41365.6 Da    PI: 8.2191
Description TCP domain protein 12
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G68800.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP135.16.4e-421112373133
          TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskks 100
                  +k+drhski+T++g+RdRR+Rls+++a++fFdLqd+LGfdk+sktieWL+ ++k++ik+l +  + s+     ++++ ++++++  k ++ +   +k+
  AT1G68800.1 111 KKRDRHSKICTAQGPRDRRMRLSLQIARKFFDLQDMLGFDKASKTIEWLFSKSKTSIKQLKERVAASE--GGGKDEHLQVDEKE--KDETLKLRVSKR 204
                  79*************************************************************44443..44455555555333..333444455555 PP

          TCP 101 qksaasalnlakesrakarararertrekmrik 133
                  ++++ + + + kesr++ar+rarert  km+++
  AT1G68800.1 205 RTKTMESSFKTKESRERARKRARERTMAKMKMR 237
                  555555577777*******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.7E-35111236IPR005333Transcription factor, TCP
PROSITE profilePS5136935.998112170IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.59216233IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000232anatomyaxillary bud meristem
PO:0004709anatomyaxillary bud
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MFPSLDTNGY DLFDPFIPHQ TTMFPSFITH IQSPNSHHHY SSPSFPFSSD FLESFDESFL  60
INQFLLQQQD VAANVVESPW KFCKKLELKK KNEKCVDGST SQEVQWRRTV KKRDRHSKIC  120
TAQGPRDRRM RLSLQIARKF FDLQDMLGFD KASKTIEWLF SKSKTSIKQL KERVAASEGG  180
GKDEHLQVDE KEKDETLKLR VSKRRTKTME SSFKTKESRE RARKRARERT MAKMKMRLFE  240
TSETISDPHQ ETREIKITNG VQLLEKENKE QEWSNTNDVH MVEYQMDSVS IIEKFLGLTS  300
DSSSSSIFGD SEECYTSLSS VRGMSTPREH NTTSIATVDE EKSPISSFSL YDYLCY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218228RERARKRARER
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.648930.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864939720.0
Expression AtlasAT1G68800-
AtGenExpressAT1G68800-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in axillary mersitems which appears in the axils of leaves after flowering. During bud vegetative development, down-regulated in the outer layers of the meristem, but accumulates transiently in young leaf primordia. In buds bearing flowers, restricted to the provascular tissue underlying the bud. Accumulates in axillary buds, but disappears at the time of bud outgrowth. {ECO:0000269|PubMed:17307924}.
UniprotTISSUE SPECIFICITY: Expressed in axillary buds, and, to a lower extent, in axillary structures such as flowers and siliques. {ECO:0000269|PubMed:17307924}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a TCP transcription factor, closely related to teosinte branched1, arrests axillary bud development and prevents axillary bud outgrowth. Transcription level and mutant phenotype are weaker than its homolog BRC1 (At3G18550).
UniProtTranscription factor that prevents axillary bud outgrowth. May also delay early axillary bud development. Probably involved in the auxin-induced control of apical dominance. {ECO:0000269|PubMed:17307924}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G68800.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed transiently after shoot apical meristem (SAM) decapitation (release from apical dominance). {ECO:0000269|PubMed:17307924}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G68800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4085610.0AM408561.1 Arabidopsis thaliana mRNA for BRANCHED2 (brc2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177047.20.0TCP domain protein 12
SwissprotA0AQW40.0TCP12_ARATH; Transcription factor TCP12
TrEMBLA0A1P8AWJ00.0A0A1P8AWJ0_ARATH; TCP domain protein 12
STRINGAT1G68800.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116322533
Representative plantOGRP18015163
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Damerval C,Le Guilloux M,Jager M,Charon C
    Diversity and evolution of CYCLOIDEA-like TCP genes in relation to flower development in Papaveraceae.
    Plant Physiol., 2007. 143(2): p. 759-72
    [PMID:17189327]
  3. Aguilar-Martínez JA,Poza-Carrión C,Cubas P
    Arabidopsis BRANCHED1 acts as an integrator of branching signals within axillary buds.
    Plant Cell, 2007. 19(2): p. 458-72
    [PMID:17307924]
  4. Finlayson SA,Krishnareddy SR,Kebrom TH,Casal JJ
    Phytochrome regulation of branching in Arabidopsis.
    Plant Physiol., 2010. 152(4): p. 1914-27
    [PMID:20154098]
  5. Su H,Abernathy SD,White RH,Finlayson SA
    Photosynthetic photon flux density and phytochrome B interact to regulate branching in Arabidopsis.
    Plant Cell Environ., 2011. 34(11): p. 1986-98
    [PMID:21726239]
  6. Yang X, et al.
    Evolution of double positive autoregulatory feedback loops in CYCLOIDEA2 clade genes is associated with the origin of floral zygomorphy.
    Plant Cell, 2012. 24(5): p. 1834-47
    [PMID:22649271]
  7. Kim DY,Scalf M,Smith LM,Vierstra RD
    Advanced proteomic analyses yield a deep catalog of ubiquitylation targets in Arabidopsis.
    Plant Cell, 2013. 25(5): p. 1523-40
    [PMID:23667124]