PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G68670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 354aa    MW: 39424.2 Da    PI: 7.0299
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G68670.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-32215270156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  AT1G68670.1 215 KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 270
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.821212272IPR017930Myb domain
SuperFamilySSF466891.52E-17212273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-28213273IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-27215270IPR006447Myb domain, plants
PfamPF002495.6E-8217268IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000252anatomyendodermis
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020127anatomyprimary root
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MMVEMDYAKK MQKCHEYVEA LEEEQKKIQV FQRELPLCLE LVTQAIEACR KELSGTTTTT  60
SEQCSEQTTS VCGGPVFEEF IPIKKISSLC EEVQEEEEED GEHESSPELV NNKKSDWLRS  120
VQLWNHSPDL NPKEERVAKK AKVVEVKPKS GAFQPFQKRV LETDLQPAVK VASSMPATTT  180
SSTTETCGGK SDLIKAGDEE RRIEQQQSQS HTHRKQRRCW SPELHRRFLN ALQQLGGSHV  240
ATPKQIRDHM KVDGLTNDEV KSHLQKYRLH TRRPAATSVA AQSTGNQQQP QFVVVGGIWV  300
PSSQDFPPPS DVANKGGVYA PVAVAQSPKR SLERSCNSPA ASSSTNTNTS TPVS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.271540.0bud| flower| root| seed| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453372970.0
Genevisible262284_at0.0
Expression AtlasAT1G68670-
AtGenExpressAT1G68670-
ATTED-IIAT1G68670-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate homeostasis. Involved in the regulation of the developmental response of lateral roots, acquisition and/or mobilization of phosphate and expression of a subset of genes involved in phosphate sensing and signaling pathway. Is a target of the transcription factor PHR1. {ECO:0000269|PubMed:27016098}.
Function -- GeneRIF ? help Back to Top
  1. the role of the MYB-related TF HYPERSENSITIVITY TO LOW PHOSPHATE-ELICITED PRIMARY ROOT SHORTENING1 HOMOLOG2 (HHO2) in regulating Pi acquisition and signaling in Arabidopsis thaliana, was examined.[HHO2]
    [PMID: 27016098]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G68670.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced under phosphate deprivation conditions. {ECO:0000269|PubMed:27016098}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G68670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0638860.0AY063886.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
GenBankAY0912410.0AY091241.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564938.10.0myb-like transcription factor family protein
SwissprotQ8VZS30.0HHO2_ARATH; Transcription factor HHO2
TrEMBLA0A178WBT40.0A0A178WBT4_ARATH; Uncharacterized protein
STRINGAT1G68670.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Representative plantOGRP54151221
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  3. M
    Genome-wide analysis of the Arabidopsis leaf transcriptome reveals interaction of phosphate and sugar metabolism.
    Plant Physiol., 2007. 143(1): p. 156-71
    [PMID:17085508]
  4. Bi YM,Wang RL,Zhu T,Rothstein SJ
    Global transcription profiling reveals differential responses to chronic nitrogen stress and putative nitrogen regulatory components in Arabidopsis.
    BMC Genomics, 2007. 8: p. 281
    [PMID:17705847]
  5. Peng M,Bi YM,Zhu T,Rothstein SJ
    Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA.
    Plant Mol. Biol., 2007. 65(6): p. 775-97
    [PMID:17885809]
  6. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  7. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  8. Cui H, et al.
    Genome-wide direct target analysis reveals a role for SHORT-ROOT in root vascular patterning through cytokinin homeostasis.
    Plant Physiol., 2011. 157(3): p. 1221-31
    [PMID:21951467]
  9. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  10. Cui H,Hao Y,Kong D
    SCARECROW has a SHORT-ROOT-independent role in modulating the sugar response.
    Plant Physiol., 2012. 158(4): p. 1769-78
    [PMID:22312006]
  11. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]
  12. Sun X, et al.
    The GARP/MYB-related grape transcription factor AQUILO improves cold tolerance and promotes the accumulation of raffinose family oligosaccharides.
    J. Exp. Bot., 2018. 69(7): p. 1749-1764
    [PMID:29385617]