PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G67710.1
Common NameARP3, ARR11, F12A21.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 521aa    MW: 58578.5 Da    PI: 4.9337
Description response regulator 11
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G67710.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.35.5e-26193247155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r++W+ eLH++Fv+av+q+G  +kA Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  AT1G67710.1 193 KARVVWSFELHHKFVNAVNQIGCDHKAGPKKILDLMNVPWLTRENVASHLQKYRL 247
                  68****************************************************8 PP

2Response_reg80.26.7e-27131191107
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+k  y ev+++  ++eal+ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + ++ Ga 
   AT1G67710.1  13 VLVVDDDPTWLKILEKMLKKCSY-EVTTCGLAREALRLLRERKdgYDIVISDVNMPDMDGFKLLEHVGLEL-DLPVIMMSVDGETSRVMKGVQHGAC 107
                   89*********************.***************999999**********************5543.7************************ PP

                   EEEESS--HHHH CS
  Response_reg  96 dflsKpfdpeel 107
                   d+l Kp+ ++el
   AT1G67710.1 108 DYLLKPIRMKEL 119
                   *******99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.6E-1531515IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.0E-4310134No hitNo description
SuperFamilySSF521721.85E-3510132IPR011006CheY-like superfamily
SMARTSM004485.6E-3211123IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.75512127IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.8E-2413120IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.03E-3014127No hitNo description
Gene3DG3DSA:1.10.10.601.5E-27190252IPR009057Homeodomain-like
SuperFamilySSF466895.2E-16191251IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-22193247IPR006447Myb domain, plants
PfamPF002494.5E-7195246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0006079anatomyshoot system meristem
PO:0006339anatomyjuvenile vascular leaf
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MEKSGFSPVG LRVLVVDDDP TWLKILEKML KKCSYEVTTC GLAREALRLL RERKDGYDIV  60
ISDVNMPDMD GFKLLEHVGL ELDLPVIMMS VDGETSRVMK GVQHGACDYL LKPIRMKELK  120
IIWQHVLRKK LQEVRDIEGC GYEGGADWIT RYDEAHFLGG GEDVSFGKKR KDFDFEKKLL  180
QDESDPSSSS SKKARVVWSF ELHHKFVNAV NQIGCDHKAG PKKILDLMNV PWLTRENVAS  240
HLQKYRLYLS RLEKGKELKC YSGGVKNADS SPKDVEVNSG YQSPGRSSYV FSGGNSLIQK  300
ATEIDPKPLA SASLSDLNTD VIMPPKTKKT RIGFDPPISS SAFDSLLPWN DVPEVLESKP  360
VLYENSFLQQ QPLPSQSSYV ANSAPSLMEE EMKPPYETPA GGSSVNADEF LMPQDKIPTV  420
TLQDLDPSAM KLQEFNTEAI LRSLNWELPE SHHSVSLDTD LDLTWLQGER FLANTGLQFQ  480
DYSSSPSLLS ELPAHLNWYG NERLPDPDEY SFMVDQGLFI S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-17189252163ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.1210.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306975580.0
Genevisible245186_at0.0
Expression AtlasAT1G67710-
AtGenExpressAT1G67710-
ATTED-IIAT1G67710-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in roots and stems. {ECO:0000269|PubMed:15173562}.
Functional Description ? help Back to Top
Source Description
TAIREncodes an Arabidopsis response regulator (ARR) protein that acts in concert with other type-B ARRs in the cytokinin signaling pathway.
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins (By similarity). {ECO:0000250, ECO:0000269|PubMed:12610214}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G67710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDcytokinin
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FXD6
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G67710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2282160.0AK228216.1 Arabidopsis thaliana mRNA for response regulator 11, complete cds, clone: RAFL14-66-N10.
GenBankBT0087680.0BT008768.1 Arabidopsis thaliana At1g67710 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176938.10.0response regulator 11
SwissprotQ9FXD60.0ARR11_ARATH; Two-component response regulator ARR11
TrEMBLQ0WRT00.0Q0WRT0_ARATH; Two-component response regulator
STRINGAT1G67710.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80662740
Representative plantOGRP29217120
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  3. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  4. Imamura A,Kiba T,Tajima Y,Yamashino T,Mizuno T
    In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana.
    Plant Cell Physiol., 2003. 44(2): p. 122-31
    [PMID:12610214]
  5. Heyl A,Schm
    Cytokinin signal perception and transduction.
    Curr. Opin. Plant Biol., 2003. 6(5): p. 480-8
    [PMID:12972049]
  6. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  7. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  8. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  9. Tajima Y, et al.
    Comparative studies on the type-B response regulators revealing their distinctive properties in the His-to-Asp phosphorelay signal transduction of Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(1): p. 28-39
    [PMID:14749483]
  10. Cluis CP,Mouchel CF,Hardtke CS
    The Arabidopsis transcription factor HY5 integrates light and hormone signaling pathways.
    Plant J., 2004. 38(2): p. 332-47
    [PMID:15078335]
  11. Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
    Type-B response regulators display overlapping expression patterns in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 927-37
    [PMID:15173562]
  12. Shahollari B,Varma A,Oelm
    Expression of a receptor kinase in Arabidopsis roots is stimulated by the basidiomycete Piriformospora indica and the protein accumulates in Triton X-100 insoluble plasma membrane microdomains.
    J. Plant Physiol., 2005. 162(8): p. 945-58
    [PMID:16146321]
  13. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  14. Mason MG, et al.
    Multiple type-B response regulators mediate cytokinin signal transduction in Arabidopsis.
    Plant Cell, 2005. 17(11): p. 3007-18
    [PMID:16227453]
  15. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  16. Siemens J, et al.
    Transcriptome analysis of Arabidopsis clubroots indicate a key role for cytokinins in disease development.
    Mol. Plant Microbe Interact., 2006. 19(5): p. 480-94
    [PMID:16673935]
  17. Nakano T, et al.
    Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana.
    J. Plant Res., 2006. 119(4): p. 407-13
    [PMID:16820983]
  18. Dortay H,Mehnert N,B
    Analysis of protein interactions within the cytokinin-signaling pathway of Arabidopsis thaliana.
    FEBS J., 2006. 273(20): p. 4631-44
    [PMID:16965536]
  19. Ishida K,Yamashino T,Yokoyama A,Mizuno T
    Three type-B response regulators, ARR1, ARR10 and ARR12, play essential but redundant roles in cytokinin signal transduction throughout the life cycle of Arabidopsis thaliana.
    Plant Cell Physiol., 2008. 49(1): p. 47-57
    [PMID:18037673]
  20. Gifford ML,Dean A,Gutierrez RA,Coruzzi GM,Birnbaum KD
    Cell-specific nitrogen responses mediate developmental plasticity.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(2): p. 803-8
    [PMID:18180456]
  21. Song YH, et al.
    DNA-binding study identifies C-box and hybrid C/G-box or C/A-box motifs as high-affinity binding sites for STF1 and LONG HYPOCOTYL5 proteins.
    Plant Physiol., 2008. 146(4): p. 1862-77
    [PMID:18287490]
  22. Nemoto K, et al.
    Autophosphorylation profiling of Arabidopsis protein kinases using the cell-free system.
    Phytochemistry, 2011. 72(10): p. 1136-44
    [PMID:21477822]
  23. Kushwah S,Jones AM,Laxmi A
    Cytokinin interplay with ethylene, auxin, and glucose signaling controls Arabidopsis seedling root directional growth.
    Plant Physiol., 2011. 156(4): p. 1851-66
    [PMID:21666052]
  24. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  25. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  26. Hill K, et al.
    Functional characterization of type-B response regulators in the Arabidopsis cytokinin response.
    Plant Physiol., 2013. 162(1): p. 212-24
    [PMID:23482873]
  27. Zwack PJ, et al.
    Cytokinin Response Factor 6 Represses Cytokinin-Associated Genes during Oxidative Stress.
    Plant Physiol., 2016. 172(2): p. 1249-1258
    [PMID:27550996]
  28. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]