PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G66380.1
Common NameAtMYB114, MYB114, T27F4.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 139aa    MW: 16006.7 Da    PI: 10.9187
Description myb domain protein 114
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G66380.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
      AT1G66380.1 10 KGAWTAEEDSLLRQCIGKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
                     79*********************************************7 PP

2Myb_DNA-binding53.55.5e-1763108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
      AT1G66380.1  63 RGKFSSDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.73561IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-22560IPR009057Homeodomain-like
SuperFamilySSF466892.68E-297104IPR009057Homeodomain-like
SMARTSM007171.5E-14959IPR001005SANT/Myb domain
PfamPF002491.2E-151057IPR001005SANT/Myb domain
CDDcd001672.01E-101257No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2461111IPR009057Homeodomain-like
SMARTSM007177.5E-1662110IPR001005SANT/Myb domain
PROSITE profilePS5129420.90962112IPR017930Myb domain
PfamPF002491.4E-1563108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0007275Biological Processmulticellular organism development
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MEGSSKGLRK GAWTAEEDSL LRQCIGKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS  60
IKRGKFSSDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHEPCCKTKI  120
KRINIITPPN TPAQKVDIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2381115107B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260139_at0.0
Expression AtlasAT1G66380-
AtGenExpressAT1G66380-
ATTED-IIAT1G66380-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the MYB family of transcription factors. Involved in regulation of anthocyanin biosynthesis. Affects the expression of enzymes involved in later steps of anthocyanin biosynthesis
UniProtTranscription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}.
Function -- GeneRIF ? help Back to Top
  1. This study showed that overexpression of Myb113 or Myb114 results in substantial increases in pigment production, and that pigment production remains TTG1- and bHLH-dependent.
    [PMID: 18036197]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G66380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDjasmonic acid
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FNV8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G66380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0083790.0AY008379.1 Arabidopsis thaliana putative transcription factor MYB114 mRNA, complete cds.
GenBankAY5195670.0AY519567.1 Arabidopsis thaliana MYB transcription factor (At1g66380) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176812.15e-99myb domain protein 114
SwissprotQ9FNV81e-100MY114_ARATH; Transcription factor MYB114
TrEMBLD7KTP51e-83D7KTP5_ARALL; MYB transcription factor
STRINGAT1G66380.12e-98(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  4. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  5. Downie A, et al.
    Expression profiling of the response of Arabidopsis thaliana to methanol stimulation.
    Phytochemistry, 2004. 65(16): p. 2305-16
    [PMID:15381001]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  8. Gonzalez A,Zhao M,Leavitt JM,Lloyd AM
    Regulation of the anthocyanin biosynthetic pathway by the TTG1/bHLH/Myb transcriptional complex in Arabidopsis seedlings.
    Plant J., 2008. 53(5): p. 814-27
    [PMID:18036197]
  9. Heppel SC, et al.
    Identification of key amino acids for the evolution of promoter target specificity of anthocyanin and proanthocyanidin regulating MYB factors.
    Plant Mol. Biol., 2013. 82(4-5): p. 457-71
    [PMID:23689818]
  10. Li S,Zachgo S
    TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana.
    Plant J., 2013. 76(6): p. 901-13
    [PMID:24118612]
  11. Li T, et al.
    Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83
    [PMID:25450360]
  12. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]