PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G66370.1
Common NameAtMYB113, MYB113, T27F4.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 246aa    MW: 28307.5 Da    PI: 8.8
Description myb domain protein 113
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G66370.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WTteEd ll +++ ++G g W++++ + g++R++k+c++rw++yl
      AT1G66370.1 10 KGTWTTEEDILLRQCIDKYGEGKWHRVPLRTGLNRCRKSCRLRWLNYL 57
                     799*******************************************97 PP

2Myb_DNA-binding42.12e-1369108748
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +E +l ++++k+lG++ W++Ia +++ gRt++++k++w+++l
      AT1G66370.1  69 DEVDLVLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                      788999**********.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.913561IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-20659IPR009057Homeodomain-like
SuperFamilySSF466891.22E-267104IPR009057Homeodomain-like
SMARTSM007177.1E-14959IPR001005SANT/Myb domain
PfamPF002493.5E-151057IPR001005SANT/Myb domain
CDDcd001671.42E-91257No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2060111IPR009057Homeodomain-like
PROSITE profilePS5129418.06662112IPR017930Myb domain
SMARTSM007173.9E-1162110IPR001005SANT/Myb domain
PfamPF002497.2E-1269108IPR001005SANT/Myb domain
CDDcd001675.43E-969108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0007275Biological Processmulticellular organism development
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGESPKGLRK GTWTTEEDIL LRQCIDKYGE GKWHRVPLRT GLNRCRKSCR LRWLNYLKPS  60
IKRGKLCSDE VDLVLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHDERCCKTK  120
MINKNITSHP TSSAQKIDVL KPRPRSFSDK NSCNDVNILP KVDVVPLHLG LNNNYVCESS  180
ITCNKDEQKD KLININLLDG DNMWWESLLE ADVLGPEATE TAKGVTLPLD FEQIWARFDE  240
ETLELN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2181135109B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO116411210.0
Genevisible260134_at0.0
Expression AtlasAT1G66370-
AtGenExpressAT1G66370-
ATTED-IIAT1G66370-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the MYB family of transcription factors. Involved in regulation of anthocyanin biosynthesis. Affects the expression of enzymes involved in later steps of anthocyanin biosynthesis.
UniProtTranscription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}.
Function -- GeneRIF ? help Back to Top
  1. This study showed that overexpression of Myb113 or Myb114 results in substantial increases in pigment production, and that pigment production remains TTG1- and bHLH-dependent.
    [PMID: 18036197]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G66370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDjasmonic acid
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FNV9
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G66370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0083780.0AY008378.1 Arabidopsis thaliana putative transcription factor MYB113 mRNA, complete cds.
GenBankAY5195660.0AY519566.1 Arabidopsis thaliana MYB transcription factor (At1g66370) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176811.10.0myb domain protein 113
SwissprotQ9FNV90.0MY113_ARATH; Transcription factor MYB113
TrEMBLA0A178W1H81e-179A0A178W1H8_ARATH; MYB113
STRINGAT1G66370.11e-180(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Rajagopalan R,Vaucheret H,Trejo J,Bartel DP
    A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana.
    Genes Dev., 2006. 20(24): p. 3407-25
    [PMID:17182867]
  6. Gonzalez A,Zhao M,Leavitt JM,Lloyd AM
    Regulation of the anthocyanin biosynthetic pathway by the TTG1/bHLH/Myb transcriptional complex in Arabidopsis seedlings.
    Plant J., 2008. 53(5): p. 814-27
    [PMID:18036197]
  7. Luo QJ,Mittal A,Jia F,Rock CD
    An autoregulatory feedback loop involving PAP1 and TAS4 in response to sugars in Arabidopsis.
    Plant Mol. Biol., 2012. 80(1): p. 117-29
    [PMID:21533841]
  8. Chiu LW,Li L
    Characterization of the regulatory network of BoMYB2 in controlling anthocyanin biosynthesis in purple cauliflower.
    Planta, 2012. 236(4): p. 1153-64
    [PMID:22644767]
  9. Li S,Zachgo S
    TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana.
    Plant J., 2013. 76(6): p. 901-13
    [PMID:24118612]
  10. Li T, et al.
    Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83
    [PMID:25450360]
  11. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]