PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G65910.1
Common Nameanac028, F12P19.8, NAC028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 631aa    MW: 71907.6 Da    PI: 6.6184
Description NAC domain containing protein 28
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G65910.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.91.4e-5561341129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  +ppGfrFhPtdeelv +yLk+k++g+++el e+i+e+d+yk+ePwdLp k  + +++ ew+fFs+rd+ky++g+r+nratk+gyWkatgkd++v+s +
  AT1G65910.1   6 MPPGFRFHPTDEELVIYYLKRKINGRTIEL-EIIPEIDLYKCEPWDLPgKsLLPSKDLEWFFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVTS-H 101
                  79****************************.99***************6434555777**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                  ++ vg+kktLv+y+grap+g++tdWvmheyrle
  AT1G65910.1 102 SRMVGTKKTLVYYRGRAPHGSRTDWVMHEYRLE 134
                  99*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-644156IPR003441NAC domain
PROSITE profilePS5100561.1156156IPR003441NAC domain
PfamPF023652.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MAPVSMPPGF RFHPTDEELV IYYLKRKING RTIELEIIPE IDLYKCEPWD LPGKSLLPSK  60
DLEWFFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVTS HSRMVGTKKT LVYYRGRAPH  120
GSRTDWVMHE YRLEEQECDS KSGIQDAYAL CRVFKKSALA NKIEEQHHGT KKNKGTTNSE  180
QSTSSTCLYS DGMYENLENS GYPVSPETGG LTQLGNNSSS DMETIENKWS QFMSHDTSFN  240
FPPQSQYGTI SYPPSKVDIA LECARLQNRM LPPVPPLYVE GLTHNEYFGN NVANDTDEML  300
SKIIALAQAS HEPRNSLDSW DGGSASGNFH GDFNYSGEKV SCLEANVEAV DMQEHHVNFK  360
EERLVENLRW VGVSSKELEK SFVEEHSTVI PIEDIWRYHN DNQEQEHHDQ DGMDVNNNNG  420
DVDDAFTLEF SENEHNENLL DKNDHETTSS SCFEVVKKVE VSHGLFVTTR QVTNTFFQQI  480
VPSQTVIVYI NPTDGNECCH SMTSKEEVHV RKKINPRING VSSTVLGQWR KFAHVIGFIP  540
MLLLMRCVHR GNSNKNRGSE GYSRQPTRGD CNNRGTILMM ENAVVRRKIW KKKKEKNMVD  600
EQGFRFQDSF VLKKLGLSLA IILAVSTISL I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-57116212171NO APICAL MERISTEM PROTEIN
1ut4_B5e-57116212171NO APICAL MERISTEM PROTEIN
1ut7_A5e-57116212171NO APICAL MERISTEM PROTEIN
1ut7_B5e-57116212171NO APICAL MERISTEM PROTEIN
3swm_A6e-57116215174NAC domain-containing protein 19
3swm_B6e-57116215174NAC domain-containing protein 19
3swm_C6e-57116215174NAC domain-containing protein 19
3swm_D6e-57116215174NAC domain-containing protein 19
3swp_A6e-57116215174NAC domain-containing protein 19
3swp_B6e-57116215174NAC domain-containing protein 19
3swp_C6e-57116215174NAC domain-containing protein 19
3swp_D6e-57116215174NAC domain-containing protein 19
4dul_A5e-57116212171NAC domain-containing protein 19
4dul_B5e-57116212171NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261916_at0.0
Expression AtlasAT1G65910-
AtGenExpressAT1G65910-
ATTED-IIAT1G65910-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G65910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G65910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF12P190.0AC009513.2 Sequence of BAC F12P19 from Arabidopsis thaliana chromosome 1, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176766.10.0NAC domain containing protein 28
TrEMBLQ9SRZ80.0Q9SRZ8_ARATH; F12P19.8 protein
STRINGAT1G65910.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101122632
Representative plantOGRP87171015
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]