PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G65620.1
Common NameAS2, F5I14.15, LBD6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 199aa    MW: 21709.5 Da    PI: 7.533
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G65620.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.31.8e-4591081100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l+ +k
  AT1G65620.1   9 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPSQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQIDLSCAK 106
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  +e
  AT1G65620.1 107 SE 108
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.2018109IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-449106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000017anatomyvascular leaf primordium
PO:0000025anatomyroot tip
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0006018anatomyleaf adaxial epidermis
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MASSSTNSPC AACKFLRRKC QPECVFAPYF PPDQPQKFAN VHKVFGASNV TKLLNELHPS  60
QREDAVNSLA YEADMRLRDP VYGCVGVISL LQHQLRQLQI DLSCAKSELS KYQSLGILAA  120
THQSLGINLL AGAADGTATA VRDHYHHHQF FPREQMFGGL DVPAGNNYDG GILAIGQITQ  180
FQQPRAAAGD DGRRTVDPS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453372020.0
Genevisible264626_at0.0
Expression AtlasAT1G65620-
AtGenExpressAT1G65620-
ATTED-IIAT1G65620-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves, flowers and adaxial domains of cotyledonary and leaves primordia. {ECO:0000269|PubMed:12040093, ECO:0000269|PubMed:12068116, ECO:0000269|PubMed:17559509}.
Functional Description ? help Back to Top
Source Description
TAIRrequired for formation of a symmetric flat leaf lamina, encodes a member of a family of proteins characterized by cysteine repeats and a leucine zipper; involved in KNOX gene regulation. Acts together with ASL1 in proximal-distal symmetry determination. Forms a complex with AS1 that binds to the BP promoter and leads to silencing of BP.
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 1 (AS1) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11311158, PubMed:12787254, PubMed:12874130, PubMed:14508003, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509). Required for the binding of AS1 to the KNOX genes (PubMed:23271976). {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:12874130, ECO:0000269|PubMed:14508003, ECO:0000269|PubMed:16006579, ECO:0000269|PubMed:16699177, ECO:0000269|PubMed:17395603, ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:23271976}.
Function -- GeneRIF ? help Back to Top
  1. AS2 genes are important for repressing class I KNOTTED1-like homeobox (KNOX) genes and specifying leaf adaxial identity in leaf development
    [PMID: 16006579]
  2. RDR6, SGS3 and AGO7 act in the same pathway, which genetically interacts with the AS1-AS2 pathway for leaf development.
    [PMID: 16699177]
  3. Results suggest that histone deacetylases HDT1/HD2A and HDT2/HD2B, and ASYMMETRIC LEAVES (AS) 1 and 2 act independently to control levels and/or patterns of miR165/166 distribution and the development of adaxial-abaxial leaf polarity.
    [PMID: 17293570]
  4. AS2 represses cell proliferation in the adaxial domain in the presence of asymmetric leaves 1, and adaxial expression of AS2 at an appropriate level is critical for the development of a symmetrical, expanded lamina.
    [PMID: 17559509]
  5. A previously unrecognized fundamental regulation by which AS1, AS2, and JAG act to define sepal and petal from their boundaries is reported.
    [PMID: 18156293]
  6. results of studying new alleles of AS1 and AS2 support their role in control of class I KNOX genes and auxin transport.
    [PMID: 18409376]
  7. AS1, AS2 and the AS1-AS2 protein complex may have distinct functions, which are all required for normal plant development.
    [PMID: 18713400]
  8. KAN1 acts as a transcriptional repressor and that mutually repressive interactions between KAN1 and AS2 contribute to the establishment of adaxial-abaxial polarity in plants
    [PMID: 18849474]
  9. Results revealed that the reduction in leaf size and late flowering were caused by the repression, by KNOX genes, of a gibberellin (GA) pathway in as1 and as2 plants.
    [PMID: 19891706]
  10. BOP1/2 activity is required for AS2 activation specifically in the proximal region of the leaf and that BOP1 is a direct upstream regulator of AS2 during leaf development.
    [PMID: 20118228]
  11. ELO3 mediated establishment of leaf polarity independently of AS2 and the trans-acting small interfering RNA-related pathway.
    [PMID: 21700721]
  12. AS2 might be involved in the determination of abaxial polarity in cockscomb plants.
    [PMID: 22143880]
  13. These results suggest that AS2 bodies function to properly distribute AS2 to daughter cells during cell division in leaf primordia; and this process is controlled at least partially by signals encoded by the AS2 sequence itself.
    [PMID: 22351044]
  14. AS2 and the miRNA319-targeted TCP transcription factors form protein complexes, which associate with promoter regions and downregulate BP and KNAT2 expression.
    [PMID: 22380849]
  15. The JLO and AS2 proteins interact molecularly and form multimeric complexes with AS1 to suppress KNOX expression. AS2 together with JLO regulate auxin transport in seedling roots.
    [PMID: 22822207]
  16. Negative transcriptional, post-transcriptional and epigenetic regulation of ARF3 by AS1-AS2 is important for stabilizing early leaf partitioning into abaxial and adaxial domains.
    [PMID: 23571218]
  17. ASYMMETRIC LEAVES2 expression is critical for leaf axial patterning.
    [PMID: 24006428]
  18. These data points to a general requirement for AS2 repression in meristematic regions to allow cell proliferation.
    [PMID: 25807065]
  19. We found that AS2 promotes DCP2 decapping activity, accelerates mRNA turnover rate, inhibits siRNA accumulation and functions as an endogenous suppressor of post-transcriptional gene silencing
    [PMID: 26431425]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G65620.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by SHOOT MERISTEMLESS (STM). {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G62360 (R), AT2G34710 (A), AT4G00180 (R), AT5G16560 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G23380(R), AT1G32240(R), AT1G62360(R), AT1G70510(R), AT2G26580(R), AT2G33860(R), AT2G34710(A), AT2G45190(R), AT3G15170(R), AT4G00180(R), AT4G08150(R), AT5G03680(R), AT5G16560(R), AT5G53950(R), AT5G63090(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDGibberellin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G65620
IntActSearch O04479
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G65620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF5I140.0AC001229.1 Sequence of BAC F5I14 from Arabidopsis thaliana chromosome 1, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankBT0251630.0BT025163.1 Arabidopsis thaliana At1g65620 mRNA, complete cds.
GenBankAY5194830.0AY519483.1 Arabidopsis thaliana ecotype Blanes AS2 (At1G65620) gene, complete cds.
GenBankAB4738330.0AB473833.1 Arabidopsis thaliana AS2 mRNA for ASYMMETRIC LEAVES2, complete cds.
GenBankAB0808020.0AB080802.1 Arabidopsis thaliana AS2 mRNA for ASYMMETRIC LEAVES2, complete cds.
GenBankAF4478870.0AF447887.1 Arabidopsis thaliana LOB DOMAIN 6 (LBD6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077777.11e-148protein ASYMMETRIC LEAVES 2
RefseqNP_001077778.11e-148protein ASYMMETRIC LEAVES 2
RefseqNP_001117553.11e-148protein ASYMMETRIC LEAVES 2
RefseqNP_176739.11e-148protein ASYMMETRIC LEAVES 2
SwissprotO044791e-150LBD6_ARATH; LOB domain-containing protein 6
TrEMBLR0GIM51e-136R0GIM5_9BRAS; Uncharacterized protein
STRINGAT1G65620.11e-147(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MalvidsOGEM126792531
Publications ? help Back to Top
  1. Ori N,Eshed Y,Chuck G,Bowman JL,Hake S
    Mechanisms that control knox gene expression in the Arabidopsis shoot.
    Development, 2000. 127(24): p. 5523-32
    [PMID:11076771]
  2. Semiarti E, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana regulates formation of a symmetric lamina, establishment of venation and repression of meristem-related homeobox genes in leaves.
    Development, 2001. 128(10): p. 1771-83
    [PMID:11311158]
  3. Byrne ME,Simorowski J,Martienssen RA
    ASYMMETRIC LEAVES1 reveals knox gene redundancy in Arabidopsis.
    Development, 2002. 129(8): p. 1957-65
    [PMID:11934861]
  4. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  5. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  6. Ha CM, et al.
    The BLADE-ON-PETIOLE 1 gene controls leaf pattern formation through the modulation of meristematic activity in Arabidopsis.
    Development, 2003. 130(1): p. 161-72
    [PMID:12441300]
  7. Takada S,Tasaka M
    Embryonic shoot apical meristem formation in higher plants.
    J. Plant Res., 2002. 115(6): p. 411-7
    [PMID:12579444]
  8. Micol JL,Hake S
    The development of plant leaves.
    Plant Physiol., 2003. 131(2): p. 389-94
    [PMID:12586863]
  9. Nakazawa M, et al.
    Activation tagging, a novel tool to dissect the functions of a gene family.
    Plant J., 2003. 34(5): p. 741-50
    [PMID:12787254]
  10. Xu L, et al.
    Novel as1 and as2 defects in leaf adaxial-abaxial polarity reveal the requirement for ASYMMETRIC LEAVES1 and 2 and ERECTA functions in specifying leaf adaxial identity.
    Development, 2003. 130(17): p. 4097-107
    [PMID:12874130]
  11. Lin WC,Shuai B,Springer PS
    The Arabidopsis LATERAL ORGAN BOUNDARIES-domain gene ASYMMETRIC LEAVES2 functions in the repression of KNOX gene expression and in adaxial-abaxial patterning.
    Plant Cell, 2003. 15(10): p. 2241-52
    [PMID:14508003]
  12. Hibara K,Takada S,Tasaka M
    CUC1 gene activates the expression of SAM-related genes to induce adventitious shoot formation.
    Plant J., 2003. 36(5): p. 687-96
    [PMID:14617069]
  13. Katz A,Oliva M,Mosquna A,Hakim O,Ohad N
    FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development.
    Plant J., 2004. 37(5): p. 707-19
    [PMID:14871310]
  14. Qi Y,Sun Y,Xu L,Xu Y,Huang H
    ERECTA is required for protection against heat-stress in the AS1/ AS2 pathway to regulate adaxial-abaxial leaf polarity in Arabidopsis.
    Planta, 2004. 219(2): p. 270-6
    [PMID:15034716]
  15. Cnops G, et al.
    The rotunda2 mutants identify a role for the LEUNIG gene in vegetative leaf morphogenesis.
    J. Exp. Bot., 2004. 55(402): p. 1529-39
    [PMID:15208345]
  16. Engstrom EM,Izhaki A,Bowman JL
    Promoter bashing, microRNAs, and Knox genes. New insights, regulators, and targets-of-regulation in the establishment of lateral organ polarity in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 685-94
    [PMID:15208415]
  17. Zgurski JM,Sharma R,Bolokoski DA,Schultz EA
    Asymmetric auxin response precedes asymmetric growth and differentiation of asymmetric leaf1 and asymmetric leaf2 Arabidopsis leaves.
    Plant Cell, 2005. 17(1): p. 77-91
    [PMID:15608337]
  18. Chalfun-Junior A, et al.
    ASYMMETRIC LEAVES2-LIKE1 gene, a member of the AS2/LOB family, controls proximal-distal patterning in Arabidopsis petals.
    Plant Mol. Biol., 2005. 57(4): p. 559-75
    [PMID:15821980]
  19. Kwon CS,Chen C,Wagner D
    WUSCHEL is a primary target for transcriptional regulation by SPLAYED in dynamic control of stem cell fate in Arabidopsis.
    Genes Dev., 2005. 19(8): p. 992-1003
    [PMID:15833920]
  20. Li H, et al.
    The Putative RNA-dependent RNA polymerase RDR6 acts synergistically with ASYMMETRIC LEAVES1 and 2 to repress BREVIPEDICELLUS and MicroRNA165/166 in Arabidopsis leaf development.
    Plant Cell, 2005. 17(8): p. 2157-71
    [PMID:16006579]
  21. Phelps-Durr TL,Thomas J,Vahab P,Timmermans MC
    Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis.
    Plant Cell, 2005. 17(11): p. 2886-98
    [PMID:16243907]
  22. Xu L, et al.
    Genetic interaction between the AS1-AS2 and RDR6-SGS3-AGO7 pathways for leaf morphogenesis.
    Plant Cell Physiol., 2006. 47(7): p. 853-63
    [PMID:16699177]
  23. Yang L, et al.
    Characterizations of a hypomorphic argonaute1 mutant reveal novel AGO1 functions in Arabidopsis lateral organ development.
    Plant Mol. Biol., 2006. 61(1-2): p. 63-78
    [PMID:16786292]
  24. Huang W, et al.
    The proteolytic function of the Arabidopsis 26S proteasome is required for specifying leaf adaxial identity.
    Plant Cell, 2006. 18(10): p. 2479-92
    [PMID:17028202]
  25. Okushima Y,Fukaki H,Onoda M,Theologis A,Tasaka M
    ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis.
    Plant Cell, 2007. 19(1): p. 118-30
    [PMID:17259263]
  26. Ueno Y, et al.
    Histone deacetylases and ASYMMETRIC LEAVES2 are involved in the establishment of polarity in leaves of Arabidopsis.
    Plant Cell, 2007. 19(2): p. 445-57
    [PMID:17293570]
  27. Fu Y, et al.
    Genetic interactions between leaf polarity-controlling genes and ASYMMETRIC LEAVES1 and 2 in Arabidopsis leaf patterning.
    Plant Cell Physiol., 2007. 48(5): p. 724-35
    [PMID:17395603]
  28. Borghi L,Bureau M,Simon R
    Arabidopsis JAGGED LATERAL ORGANS is expressed in boundaries and coordinates KNOX and PIN activity.
    Plant Cell, 2007. 19(6): p. 1795-808
    [PMID:17557810]
  29. Iwakawa H, et al.
    Expression of the ASYMMETRIC LEAVES2 gene in the adaxial domain of Arabidopsis leaves represses cell proliferation in this domain and is critical for the development of properly expanded leaves.
    Plant J., 2007. 51(2): p. 173-84
    [PMID:17559509]
  30. Alonso-Cantabrana H, et al.
    Common regulatory networks in leaf and fruit patterning revealed by mutations in the Arabidopsis ASYMMETRIC LEAVES1 gene.
    Development, 2007. 134(14): p. 2663-71
    [PMID:17592013]
  31. Ha CM,Jun JH,Nam HG,Fletcher JC
    BLADE-ON-PETIOLE 1 and 2 control Arabidopsis lateral organ fate through regulation of LOB domain and adaxial-abaxial polarity genes.
    Plant Cell, 2007. 19(6): p. 1809-25
    [PMID:17601823]
  32. Lin Z, et al.
    AtCDC5 regulates the G2 to M transition of the cell cycle and is critical for the function of Arabidopsis shoot apical meristem.
    Cell Res., 2007. 17(9): p. 815-28
    [PMID:17768399]
  33. Husbands A,Bell EM,Shuai B,Smith HM,Springer PS
    LATERAL ORGAN BOUNDARIES defines a new family of DNA-binding transcription factors and can interact with specific bHLH proteins.
    Nucleic Acids Res., 2007. 35(19): p. 6663-71
    [PMID:17913740]
  34. Nurmberg PL, et al.
    The developmental selector AS1 is an evolutionarily conserved regulator of the plant immune response.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(47): p. 18795-800
    [PMID:18003921]
  35. Xu B, et al.
    Arabidopsis genes AS1, AS2, and JAG negatively regulate boundary-specifying genes to promote sepal and petal development.
    Plant Physiol., 2008. 146(2): p. 566-75
    [PMID:18156293]
  36. Guo M,Thomas J,Collins G,Timmermans MC
    Direct repression of KNOX loci by the ASYMMETRIC LEAVES1 complex of Arabidopsis.
    Plant Cell, 2008. 20(1): p. 48-58
    [PMID:18203921]
  37. Vu KhCh,Ondar UN,Soldatova OP
    [Expression of new mutant alleles of AS1 and AS2 genes controlling leaf morphogenesis in Arabidopsis thaliana]
    Ontogenez, 2008 Jan-Feb. 39(1): p. 8-14
    [PMID:18409376]
  38. Zhu Y, et al.
    Subcellular localizations of AS1 and AS2 suggest their common and distinct roles in plant development.
    J Integr Plant Biol, 2008. 50(7): p. 897-905
    [PMID:18713400]
  39. Yang JY, et al.
    betaC1, the pathogenicity factor of TYLCCNV, interacts with AS1 to alter leaf development and suppress selective jasmonic acid responses.
    Genes Dev., 2008. 22(18): p. 2564-77
    [PMID:18794352]
  40. Wu G, et al.
    KANADI1 regulates adaxial-abaxial polarity in Arabidopsis by directly repressing the transcription of ASYMMETRIC LEAVES2.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(42): p. 16392-7
    [PMID:18849474]
  41. Soyano T,Thitamadee S,Machida Y,Chua NH
    ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis.
    Plant Cell, 2008. 20(12): p. 3359-73
    [PMID:19088331]
  42. Micol JL
    Leaf development: time to turn over a new leaf?
    Curr. Opin. Plant Biol., 2009. 12(1): p. 9-16
    [PMID:19109050]
  43. Takahashi H, et al.
    Knowledge-based fuzzy adaptive resonance theory and its application to the analysis of gene expression in plants.
    J. Biosci. Bioeng., 2008. 106(6): p. 587-93
    [PMID:19134556]
  44. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  45. Liu Z, et al.
    Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana.
    Plant J., 2009. 59(1): p. 27-38
    [PMID:19228338]
  46. Ikezaki M, et al.
    Genetic networks regulated by ASYMMETRIC LEAVES1 (AS1) and AS2 in leaf development in Arabidopsis thaliana: KNOX genes control five morphological events.
    Plant J., 2010. 61(1): p. 70-82
    [PMID:19891706]
  47. Tabata R, et al.
    Arabidopsis auxin response factor6 and 8 regulate jasmonic acid biosynthesis and floral organ development via repression of class 1 KNOX genes.
    Plant Cell Physiol., 2010. 51(1): p. 164-75
    [PMID:20007966]
  48. Jun JH,Ha CM,Fletcher JC
    BLADE-ON-PETIOLE1 coordinates organ determinacy and axial polarity in arabidopsis by directly activating ASYMMETRIC LEAVES2.
    Plant Cell, 2010. 22(1): p. 62-76
    [PMID:20118228]
  49. P
    A role for AUXIN RESISTANT3 in the coordination of leaf growth.
    Plant Cell Physiol., 2010. 51(10): p. 1661-73
    [PMID:20739302]
  50. Mangeon A,Bell EM,Lin WC,Jablonska B,Springer PS
    Misregulation of the LOB domain gene DDA1 suggests possible functions in auxin signalling and photomorphogenesis.
    J. Exp. Bot., 2011. 62(1): p. 221-33
    [PMID:20797997]
  51. Wang L, et al.
    miR396-targeted AtGRF transcription factors are required for coordination of cell division and differentiation during leaf development in Arabidopsis.
    J. Exp. Bot., 2011. 62(2): p. 761-73
    [PMID:21036927]
  52. Yuan Z, et al.
    Characterization of the AE7 gene in Arabidopsis suggests that normal cell proliferation is essential for leaf polarity establishment.
    Plant J., 2010. 64(2): p. 331-42
    [PMID:21070412]
  53. Horiguchi G, et al.
    ANGUSTIFOLIA3 plays roles in adaxial/abaxial patterning and growth in leaf morphogenesis.
    Plant Cell Physiol., 2011. 52(1): p. 112-24
    [PMID:21097896]
  54. Horiguchi G, et al.
    Differential contributions of ribosomal protein genes to Arabidopsis thaliana leaf development.
    Plant J., 2011. 65(5): p. 724-36
    [PMID:21251100]
  55. Kojima S, et al.
    Asymmetric leaves2 and Elongator, a histone acetyltransferase complex, mediate the establishment of polarity in leaves of Arabidopsis thaliana.
    Plant Cell Physiol., 2011. 52(8): p. 1259-73
    [PMID:21700721]
  56. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  57. Yamaguchi N,Yamaguchi A,Abe M,Wagner D,Komeda Y
    LEAFY controls Arabidopsis pedicel length and orientation by affecting adaxial-abaxial cell fate.
    Plant J., 2012. 69(5): p. 844-56
    [PMID:22050454]
  58. Sun SB,Song JP,Meng LS
    ASYMMETRIC LEAVES2 gene, a member of LOB/AS2 family of Arabidopsis thaliana, causes an abaxializing leaves in transgenic cockscomb.
    Mol. Biol. Rep., 2012. 39(4): p. 4927-35
    [PMID:22143880]
  59. Luo L, et al.
    Arabidopsis ASYMMETRIC LEAVES2 protein required for leaf morphogenesis consistently forms speckles during mitosis of tobacco BY-2 cells via signals in its specific sequence.
    J. Plant Res., 2012. 125(5): p. 661-8
    [PMID:22351044]
  60. Li Z,Li B,Shen WH,Huang H,Dong A
    TCP transcription factors interact with AS2 in the repression of class-I KNOX genes in Arabidopsis thaliana.
    Plant J., 2012. 71(1): p. 99-107
    [PMID:22380849]
  61. Han HJ, et al.
    The transcriptional repressor activity of ASYMMETRIC LEAVES1 is inhibited by direct interaction with calmodulin in Arabidopsis.
    Plant Cell Environ., 2012. 35(11): p. 1969-82
    [PMID:22554014]
  62. Nakagawa A, et al.
    Berberine enhances defects in the establishment of leaf polarity in asymmetric leaves1 and asymmetric leaves2 of Arabidopsis thaliana.
    Plant Mol. Biol., 2012. 79(6): p. 569-81
    [PMID:22684430]
  63. Rast MI,Simon R
    Arabidopsis JAGGED LATERAL ORGANS acts with ASYMMETRIC LEAVES2 to coordinate KNOX and PIN expression in shoot and root meristems.
    Plant Cell, 2012. 24(7): p. 2917-33
    [PMID:22822207]
  64. Mecchia MA,Debernardi JM,Rodriguez RE,Schommer C,Palatnik JF
    MicroRNA miR396 and RDR6 synergistically regulate leaf development.
    Mech. Dev., 2013. 130(1): p. 2-13
    [PMID:22889666]
  65. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  66. Coudert Y,Dievart A,Droc G,Gantet P
    ASL/LBD phylogeny suggests that genetic mechanisms of root initiation downstream of auxin are distinct in lycophytes and euphyllophytes.
    Mol. Biol. Evol., 2013. 30(3): p. 569-72
    [PMID:23112232]
  67. Gonz
    Antagonistic gene activities determine the formation of pattern elements along the mediolateral axis of the Arabidopsis fruit.
    PLoS Genet., 2012. 8(11): p. e1003020
    [PMID:23133401]
  68. Ishibashi N, et al.
    ASYMMETRIC-LEAVES2 and an ortholog of eukaryotic NudC domain proteins repress expression of AUXIN-RESPONSE-FACTOR and class 1 KNOX homeobox genes for development of flat symmetric leaves in Arabidopsis.
    Biol Open, 2012. 1(3): p. 197-207
    [PMID:23213410]
  69. Luo M, et al.
    Histone deacetylase HDA6 is functionally associated with AS1 in repression of KNOX genes in arabidopsis.
    PLoS Genet., 2012. 8(12): p. e1003114
    [PMID:23271976]
  70. Takahashi H, et al.
    Meta-analyses of microarrays of Arabidopsis asymmetric leaves1 (as1), as2 and their modifying mutants reveal a critical role for the ETT pathway in stabilization of adaxial-abaxial patterning and cell division during leaf development.
    Plant Cell Physiol., 2013. 54(3): p. 418-31
    [PMID:23396601]
  71. Sun X,Feng Z,Meng L,Zhu J,Geitmann A
    Arabidopsis ASL11/LBD15 is involved in shoot apical meristem development and regulates WUS expression.
    Planta, 2013. 237(5): p. 1367-78
    [PMID:23397191]
  72. Lodha M,Marco CF,Timmermans MC
    The ASYMMETRIC LEAVES complex maintains repression of KNOX homeobox genes via direct recruitment of Polycomb-repressive complex2.
    Genes Dev., 2013. 27(6): p. 596-601
    [PMID:23468429]
  73. Iwasaki M, et al.
    Dual regulation of ETTIN (ARF3) gene expression by AS1-AS2, which maintains the DNA methylation level, is involved in stabilization of leaf adaxial-abaxial partitioning in Arabidopsis.
    Development, 2013. 140(9): p. 1958-69
    [PMID:23571218]
  74. Chen X,Wang H,Li J,Huang H,Xu L
    Quantitative control of ASYMMETRIC LEAVES2 expression is critical for leaf axial patterning in Arabidopsis.
    J. Exp. Bot., 2013. 64(16): p. 4895-905
    [PMID:24006428]
  75. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  76. Zhang F,Tadege M
    Repression of AS2 by WOX family transcription factors is required for leaf development in Medicago and Arabidopsis.
    Plant Signal Behav, 2015. 10(7): p. e993291
    [PMID:25807065]
  77. Ye J, et al.
    Geminivirus Activates ASYMMETRIC LEAVES 2 to Accelerate Cytoplasmic DCP2-Mediated mRNA Turnover and Weakens RNA Silencing in Arabidopsis.
    PLoS Pathog., 2015. 11(10): p. e1005196
    [PMID:26431425]