PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G65330.1
Common NameAGL37, PHE1, T8F5.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 279aa    MW: 31953.4 Da    PI: 5.0952
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G65330.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.71.1e-16955248
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                 +ien+s r++tf+kR++g+lKK +EL +LC+++++ +i s+ + ++e
  AT1G65330.1  9 FIENDSVRKTTFTKRKKGMLKKFNELVTLCGVDACAVIRSPYNSIQE 55
                 8***************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.778155IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-23159IPR002100Transcription factor, MADS-box
CDDcd002667.06E-31184No hitNo description
PRINTSPR004045.6E-8222IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-22294IPR002100Transcription factor, MADS-box
PfamPF003191.2E-16952IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-82237IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000423anatomyplant zygote
PO:0006334anatomyseed micropyle
PO:0009009anatomyplant embryo
PO:0009089anatomyendosperm
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MRGKMKLSFI ENDSVRKTTF TKRKKGMLKK FNELVTLCGV DACAVIRSPY NSIQEPWPSR  60
EGVEEVMSKF MEFSVLDRTK KMVDQETFLR QRIAKETERL QKLRDENRNS QIRDLMFGCL  120
KGEVDVSHLH GRDLLDLNVF LNKYLNGVIR RVEILKENGE SSSSVPPPIG VAPTVVDASV  180
PIGFDGRMIQ DQNQNQQEPV QFQYQALYDF YDQIPKKLHD FNMKMNIDPN QSMNLDLNDG  240
EDEGIPCMDN NNYHPEIDCL ATVTTAPTDV CAPNIINDL
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264214_s_at1e-117
Expression AtlasAT1G65330-
AtGenExpressAT1G65330-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Not present in female gametophyte before fertilization. Expressed in pollen tube and at the micropylar pole of pollinated seeds. {ECO:0000269|PubMed:15619622}.
UniprotTISSUE SPECIFICITY: Male gametophyte, embryo and endosperm. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:15619622}.
Functional Description ? help Back to Top
Source Description
TAIRType I MADS-box protein, regulated by MEA and FIE, expressed transiently after fertilization in embryo and endosperm.
UniProtProbable transcription factor involved in the development of gametophytes and seeds. {ECO:0000269|PubMed:12815071}.
Function -- GeneRIF ? help Back to Top
  1. Evidence that silencing of the maternal PHERES1 allele depends on a distantly located region downstream of the PHERES1 locus.
    [PMID: 18303047]
  2. AtUBP26 is required for normal seed development and the repression of PHE1
    [PMID: 18723879]
  3. Study shows that PHERES1 is regulated by genomic imprinting, which is likely caused by the presence of repeat sequences in the proximity of the PHERES1 locus.
    [PMID: 19825646]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G65330.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA, FIS2 and FIE in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch O80805
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G65330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankT8F50.0AC004512.2 Arabidopsis thaliana chromosome 1 BAC T8F5 sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176712.10.0MADS-box transcription factor family protein
SwissprotO808050.0PHE1_ARATH; MADS-box transcription factor PHERES 1
TrEMBLA0A178W2S50.0A0A178W2S5_ARATH; PHE1
STRINGAT1G65330.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Shepard KA,Purugganan MD
    Molecular population genetics of the Arabidopsis CLAVATA2 region. The genomic scale of variation and selection in a selfing species.
    Genetics, 2003. 163(3): p. 1083-95
    [PMID:12663546]
  3. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  4. Köhler C, et al.
    The Polycomb-group protein MEDEA regulates seed development by controlling expression of the MADS-box gene PHERES1.
    Genes Dev., 2003. 17(12): p. 1540-53
    [PMID:12815071]
  5. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  6. Katz A,Oliva M,Mosquna A,Hakim O,Ohad N
    FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development.
    Plant J., 2004. 37(5): p. 707-19
    [PMID:14871310]
  7. Yadegari R,Drews GN
    Female gametophyte development.
    Plant Cell, 2004. 16 Suppl: p. S133-41
    [PMID:15075395]
  8. K
    The Arabidopsis thaliana MEDEA Polycomb group protein controls expression of PHERES1 by parental imprinting.
    Nat. Genet., 2005. 37(1): p. 28-30
    [PMID:15619622]
  9. Autran D,Huanca-Mamani W,Vielle-Calzada JP
    Genomic imprinting in plants: the epigenetic version of an Oedipus complex.
    Curr. Opin. Plant Biol., 2005. 8(1): p. 19-25
    [PMID:15653395]
  10. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  11. Ingouff M,Haseloff J,Berger F
    Polycomb group genes control developmental timing of endosperm.
    Plant J., 2005. 42(5): p. 663-74
    [PMID:15918881]
  12. Li HC, et al.
    PICKLE acts during germination to repress expression of embryonic traits.
    Plant J., 2005. 44(6): p. 1010-22
    [PMID:16359393]
  13. Baroux C,Gagliardini V,Page DR,Grossniklaus U
    Dynamic regulatory interactions of Polycomb group genes: MEDEA autoregulation is required for imprinted gene expression in Arabidopsis.
    Genes Dev., 2006. 20(9): p. 1081-6
    [PMID:16651654]
  14. Josefsson C,Dilkes B,Comai L
    Parent-dependent loss of gene silencing during interspecies hybridization.
    Curr. Biol., 2006. 16(13): p. 1322-8
    [PMID:16824920]
  15. Makarevich G, et al.
    Different Polycomb group complexes regulate common target genes in Arabidopsis.
    EMBO Rep., 2006. 7(9): p. 947-52
    [PMID:16878125]
  16. Perruc E,Kinoshita N,Lopez-Molina L
    The role of chromatin-remodeling factor PKL in balancing osmotic stress responses during Arabidopsis seed germination.
    Plant J., 2007. 52(5): p. 927-36
    [PMID:17892443]
  17. Ngo QA,Moore JM,Baskar R,Grossniklaus U,Sundaresan V
    Arabidopsis GLAUCE promotes fertilization-independent endosperm development and expression of paternally inherited alleles.
    Development, 2007. 134(22): p. 4107-17
    [PMID:17965055]
  18. Makarevich G,Villar CB,Erilova A,Köhler C
    Mechanism of PHERES1 imprinting in Arabidopsis.
    J. Cell. Sci., 2008. 121(Pt 6): p. 906-12
    [PMID:18303047]
  19. Huh JH,Bauer MJ,Hsieh TF,Fischer RL
    Cellular programming of plant gene imprinting.
    Cell, 2008. 132(5): p. 735-44
    [PMID:18329361]
  20. Bemer M,Wolters-Arts M,Grossniklaus U,Angenent GC
    The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules.
    Plant Cell, 2008. 20(8): p. 2088-101
    [PMID:18713950]
  21. Luo M, et al.
    UBIQUITIN-SPECIFIC PROTEASE 26 is required for seed development and the repression of PHERES1 in Arabidopsis.
    Genetics, 2008. 180(1): p. 229-36
    [PMID:18723879]
  22. Miyake T,Takebayashi N,Wolf DE
    Possible diversifying selection in the imprinted gene, MEDEA, in Arabidopsis.
    Mol. Biol. Evol., 2009. 26(4): p. 843-57
    [PMID:19126870]
  23. Villar CB,Erilova A,Makarevich G,Tr
    Control of PHERES1 imprinting in Arabidopsis by direct tandem repeats.
    Mol Plant, 2009. 2(4): p. 654-60
    [PMID:19825646]
  24. Jullien PE,Berger F
    Parental genome dosage imbalance deregulates imprinting in Arabidopsis.
    PLoS Genet., 2010. 6(3): p. e1000885
    [PMID:20333248]
  25. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  26. Ishikawa R, et al.
    Rice interspecies hybrids show precocious or delayed developmental transitions in the endosperm without change to the rate of syncytial nuclear division.
    Plant J., 2011. 65(5): p. 798-806
    [PMID:21251103]
  27. Schmidt A, et al.
    The Polycomb group protein MEDEA and the DNA methyltransferase MET1 interact to repress autonomous endosperm development in Arabidopsis.
    Plant J., 2013. 73(5): p. 776-87
    [PMID:23146178]
  28. Raissig MT,Bemer M,Baroux C,Grossniklaus U
    Genomic imprinting in the Arabidopsis embryo is partly regulated by PRC2.
    PLoS Genet., 2013. 9(12): p. e1003862
    [PMID:24339783]
  29. Jeong CW, et al.
    Control of Paternally Expressed Imprinted UPWARD CURLY LEAF1, a Gene Encoding an F-Box Protein That Regulates CURLY LEAF Polycomb Protein, in the Arabidopsis Endosperm.
    PLoS ONE, 2015. 10(2): p. e0117431
    [PMID:25689861]
  30. Burkart-Waco D,Ngo K,Lieberman M,Comai L
    Perturbation of parentally biased gene expression during interspecific hybridization.
    PLoS ONE, 2015. 10(2): p. e0117293
    [PMID:25719202]
  31. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  32. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]