PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G65300.1
Common NameAGL38, PHE2, T8F5.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 278aa    MW: 31658 Da    PI: 5.2253
Description AGAMOUS-like 38
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G65300.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.79.8e-161053346
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                 ien+  r++tf+kR++g+ KK  EL +LC++e++ +++s+ + +
  AT1G65300.1 10 IENSVSRKTTFTKRKKGMTKKLTELVTLCGVEACAVVYSPFNSI 53
                 9**************************************97765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.937155IPR002100Transcription factor, MADS-box
CDDcd002669.70E-32184No hitNo description
SMARTSM004322.8E-19159IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-22284IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-9222IPR002100Transcription factor, MADS-box
PfamPF003192.4E-161051IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-92237IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-93758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000423anatomyplant zygote
PO:0009089anatomyendosperm
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MKRKMKLSLI ENSVSRKTTF TKRKKGMTKK LTELVTLCGV EACAVVYSPF NSIPEAWPSR  60
EGVEDVVSKF MELSVLDRTK KMVDQETFIS QRIAKEKEQL QKLRDENHNS QIRELMFGCL  120
KGETNVYNLD GRDLQDLSLY IDKYLNGLTR RIEILIENGE SSSSLPLPIV ANAAAPVGFD  180
GPMFQYHNQN QQKPVQFQYQ ALYDFYDQIP KKIHGFNMNM NKDSNQSMVL DLNQNLNDGE  240
DEGIPCMDNN NYHPEIDCLA TVTTAPTDVC APNITNDL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11530RKTTFTKRKKGMTKKL
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264214_s_at4e-66
Expression AtlasAT1G65300-
AtGenExpressAT1G65300-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Male gametophyte, embryo and endosperm. {ECO:0000269|PubMed:12815071}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of gametophytes and seeds.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G65300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q7XJK8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G65300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412450.0AY141245.1 Arabidopsis thaliana MADS-box protein AGL38 mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankT8F50.0AC004512.2 Arabidopsis thaliana chromosome 1 BAC T8F5 sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176709.20.0AGAMOUS-like 38
SwissprotQ7XJK80.0PHE2_ARATH; MADS-box transcription factor PHERES 2
TrEMBLA0A178WQA20.0A0A178WQA2_ARATH; PHE2
STRINGAT1G65300.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Köhler C, et al.
    The Polycomb-group protein MEDEA regulates seed development by controlling expression of the MADS-box gene PHERES1.
    Genes Dev., 2003. 17(12): p. 1540-53
    [PMID:12815071]
  4. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  5. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Li HC, et al.
    PICKLE acts during germination to repress expression of embryonic traits.
    Plant J., 2005. 44(6): p. 1010-22
    [PMID:16359393]
  8. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  9. Ngo QA,Moore JM,Baskar R,Grossniklaus U,Sundaresan V
    Arabidopsis GLAUCE promotes fertilization-independent endosperm development and expression of paternally inherited alleles.
    Development, 2007. 134(22): p. 4107-17
    [PMID:17965055]
  10. Bemer M,Wolters-Arts M,Grossniklaus U,Angenent GC
    The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules.
    Plant Cell, 2008. 20(8): p. 2088-101
    [PMID:18713950]
  11. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  12. Villar CB,Erilova A,Makarevich G,Tr
    Control of PHERES1 imprinting in Arabidopsis by direct tandem repeats.
    Mol Plant, 2009. 2(4): p. 654-60
    [PMID:19825646]
  13. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  14. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]