PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G64620.1
Common NameDOF1.8, F1N19.19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 352aa    MW: 37877.7 Da    PI: 7.8723
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G64620.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.32e-3945106263
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                  k++al+cprC+s ntkfCyynnysl+qPryfCk CrryWt+GG+lrn+PvGgg rknk+sss
  AT1G64620.1  45 KDQALNCPRCNSLNTKFCYYNNYSLTQPRYFCKDCRRYWTAGGSLRNIPVGGGVRKNKRSSS 106
                  7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-343197IPR003851Zinc finger, Dof-type
PfamPF027012.8E-3346103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.86349103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDTAKWPQEF VVKPMNEIVT NTCLKQQSNP PSPATPVERK ARPEKDQALN CPRCNSLNTK  60
FCYYNNYSLT QPRYFCKDCR RYWTAGGSLR NIPVGGGVRK NKRSSSNSSS SSPSSSSSSK  120
KPLFANNNTP TPPLPHLNPK IGEAAATKVQ DLTFSQGFGN AHEVKDLNLA FSQGFGIGHN  180
HHSSIPEFLQ VVPSSSMKNN PLVSTSSSLE LLGISSSSAS SNSRPAFMSY PNVHDSSVYT  240
ASGFGLSYPQ FQEFMRPALG FSLDGGDPLR QEEGSSGTNN GRPLLPFESL LKLPVSSSST  300
NSGGNGNLKE NNDEHSDHEH EKEEGEADQS VGFWSGMLSA GASAAASGGS WQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.359790.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261950_at0.0
Expression AtlasAT1G64620-
AtGenExpressAT1G64620-
ATTED-IIAT1G64620-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00210DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G64620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q84JQ8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G64620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0040470.0BT004047.1 Arabidopsis thaliana clone RAFL14-91-B14 (R20433) putative Dof zinc finger protein (At1g64620) mRNA, complete cds.
GenBankBT0051480.0BT005148.1 Arabidopsis thaliana clone U20433 putative Dof zinc finger protein (At1g64620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564836.10.0Dof-type zinc finger DNA-binding family protein
SwissprotQ84JQ80.0DOF18_ARATH; Dof zinc finger protein DOF1.8
TrEMBLA0A178W2N80.0A0A178W2N8_ARATH; Uncharacterized protein
STRINGAT1G64620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149321720
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  6. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  7. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  8. Tian C, et al.
    An organ boundary-enriched gene regulatory network uncovers regulatory hierarchies underlying axillary meristem initiation.
    Mol. Syst. Biol., 2014. 10: p. 755
    [PMID:25358340]