PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G64530.1
Common NameF1N19.10, NLP6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 841aa    MW: 93863.5 Da    PI: 6.3008
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G64530.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.4e-29554604252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  AT1G64530.1 554 EKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 604
                  79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.461539624IPR003035RWP-RK domain
PfamPF020422.7E-26556604IPR003035RWP-RK domain
SuperFamilySSF542771.77E-21734823No hitNo description
SMARTSM006668.4E-24741823IPR000270PB1 domain
PROSITE profilePS5174519.853741823IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.5E-27742823No hitNo description
PfamPF005641.3E-18742822IPR000270PB1 domain
CDDcd064073.52E-34742822No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MELDDLDLSG SWPLDQITFA SNFKSPVIFS SSEQPFSPLW SFSETSGDVG GELYSAAVAP  60
TRFTDYSVLL ASSESETTTK ENNQVPSPSW GIMPLENPDS YCAIKAKMTQ ALRYFKESTG  120
QQHVLAQVWA PVKNRGRYVL TTSGQPFVLG PNSNGLNQYR MVSLTYMFSL DGERDGELGL  180
PGRVFRKKLP EWTPNVQYYS SKEFSRLGHA LHYNVQGTLA LPVFEPSRQL CVGVVELIMT  240
SPKINYAPEV EKVCKALEAV NLKTSEILNH ETTQICNEGR QNALAEILEI LTVVCETYKL  300
PLAQTWVPCR HRSVLAFGGG FKKSCSSFDG SCMGKVCMST SDLAVYVVDA HVWGFRDACA  360
EHHLQKGQGV AGRAFQSGNL CFCRDVTRFC KTDYPLVHYA RMFKLTSCFA VCLKSTYTGD  420
DEYVLEFFLP PAITDKSEQD CLLGSLLQTM KQHYSSLKVV SETELCENNM SLEVVEASED  480
GMVYSKLEPI RIHHPAQISK DYLELNAPEQ KVSLNSDFME NNEVDDGVER FQTLDPIPEA  540
KTVKKSERKR GKTEKTISLE VLQQYFAGSL KDAAKSLGVC PTTMKRICRQ HGISRWPSRK  600
INKVNRSLTR LKHVIDSVQG ADGSLNLTSL SPRPWPHQIP PIDIQLAKNC PPTSTSPLSN  660
LQDVKIENRD AEDSAGSSTS RASCKVNPIC ETRFRLPTHN QEPSRQVALD DSDSSSKNMT  720
NFWAHLTCQD TASPTILQHK LVSIKATYRE DIIRFKISPE SVSITELKQQ VAKRLKLETA  780
AFELKYLDDD REWVSVSCDA DLSECLDTSA AKANTLRLSV HDVTFNFGSS CESSEETMMC  840
L
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.278860.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453371660.0
Genevisible261945_at0.0
Expression AtlasAT1G64530-
AtGenExpressAT1G64530-
ATTED-IIAT1G64530-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. TCP20 and NLP6/NLP7 transcription factors control plant responses to nitrate availability.
    [PMID: 28202720]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G64530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8RWY4
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. {ECO:0000269|PubMed:18826430}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G64530
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0009330.0BT000933.1 Arabidopsis thaliana clone C104874 unknown protein (At1g64530) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176634.10.0Plant regulator RWP-RK family protein
SwissprotQ8RWY40.0NLP6_ARATH; Protein NLP6
TrEMBLA0A178W8E80.0A0A178W8E8_ARATH; Uncharacterized protein
STRINGAT1G64530.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25072666
Representative plantOGRP2991697
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  4. Castaings L, et al.
    The nodule inception-like protein 7 modulates nitrate sensing and metabolism in Arabidopsis.
    Plant J., 2009. 57(3): p. 426-35
    [PMID:18826430]
  5. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  6. Konishi M,Yanagisawa S
    Arabidopsis NIN-like transcription factors have a central role in nitrate signalling.
    Nat Commun, 2013. 4: p. 1617
    [PMID:23511481]
  7. Liseron-Monfils C, et al.
    Nitrogen transporter and assimilation genes exhibit developmental stage-selective expression in maize (Zea mays L.) associated with distinct cis-acting promoter motifs.
    Plant Signal Behav, 2014.
    [PMID:24270626]
  8. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  9. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]