PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G63100.1
Common NameF16M19.21, SCL28
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 658aa    MW: 73481.4 Da    PI: 6.9506
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G63100.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS434.29.9e-1332746541374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                  lv+lL+ c +a++s++ +++++++ar  +lasp+g +pm+Rl+ay+ eALa r+ar++++++++ pp+e +++ ++e+ +al+++++v+Pi+kf h+t
  AT1G63100.1 274 LVNLLTGCLDAIRSRNIAAINHFIARTGDLASPRGrTPMTRLIAYYIEALALRVARMWPHIFHIAPPREFDRTVEDESGNALRFLNQVTPIPKFIHFT 371
                  6899*******************************99***********************************99************************ PP

         GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                  aN+++l+a+eg+ervHiiDfdi+qGlQWp+++q+LasR ++p+++RiTg+g+    sk el+etg+rL+ fAe+++++fef++ v++rled++l++L+
  AT1G63100.1 372 ANEMLLRAFEGKERVHIIDFDIKQGLQWPSFFQSLASRINPPHHVRITGIGE----SKLELNETGDRLHGFAEAMNLQFEFHP-VVDRLEDVRLWMLH 464
                  ****************************************************....***************************.7************* PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  vk+gE++aVn+v+q+h++l + +  +   +++L l++s++P  +v++eqea+hnse++ +r++++l+yysa+fd+++++l+++s  r+kvE++l+gre
  AT1G63100.1 465 VKEGESVAVNCVMQMHKTLYDGTGAAI--RDFLGLIRSTNPIALVLAEQEAEHNSEQLETRVCNSLKYYSAMFDAIHTNLATDSLMRVKVEEMLFGRE 560
                  *******************88777777..99******************************************************************* PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdg.yrveee..........sgslvlgWkdrpLvsvSaWr 374
                  i+n+vaceg++r+erh  +++Wr++le+ GF+++ +se+++ q k+llr+++  ++g ++ve +           g ++l W+++pL+++SaW+
  AT1G63100.1 561 IRNIVACEGSHRQERHVGFRHWRRMLEQLGFRSLGVSEREVLQSKMLLRMYGsdNEGfFNVERSdednggeggrGGGVTLRWSEQPLYTISAWT 654
                  ****************************************************644559999955566888888677888**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.06248621IPR005202Transcription factor GRAS
PfamPF035143.4E-130274654IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MLAGCSSSSL LSPTRRLRSE AVAATSATVS AHFPMNTQRL DLPCSSSFSR KETPSSRPLG  60
RSISLDNSNN NNNKPIERKT KTSGCSLKQN IKLPPLATTR GNGEGFSWNN DNNNRGKSLK  120
RLAEEDESCL SRAKRTKCEN EGGFWFEHFT GQDSSSPALP FSLTCSGDDE EKVCFVPSEV  180
ISQPLPNWVD SVITELAGIG DKDVESSLPA AVKEASGGSS TSASSESRSL SHRVPEPTNG  240
SRNPYSHRGA TEERTTGNIN NNNNRNDLQR DFELVNLLTG CLDAIRSRNI AAINHFIART  300
GDLASPRGRT PMTRLIAYYI EALALRVARM WPHIFHIAPP REFDRTVEDE SGNALRFLNQ  360
VTPIPKFIHF TANEMLLRAF EGKERVHIID FDIKQGLQWP SFFQSLASRI NPPHHVRITG  420
IGESKLELNE TGDRLHGFAE AMNLQFEFHP VVDRLEDVRL WMLHVKEGES VAVNCVMQMH  480
KTLYDGTGAA IRDFLGLIRS TNPIALVLAE QEAEHNSEQL ETRVCNSLKY YSAMFDAIHT  540
NLATDSLMRV KVEEMLFGRE IRNIVACEGS HRQERHVGFR HWRRMLEQLG FRSLGVSERE  600
VLQSKMLLRM YGSDNEGFFN VERSDEDNGG EGGRGGGVTL RWSEQPLYTI SAWTTGGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4531165339374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.660820.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184077330.0
Genevisible259686_at0.0
Expression AtlasAT1G63100-
AtGenExpressAT1G63100-
ATTED-IIAT1G63100-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and sepals. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G63100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G63100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0107950.0AC010795.5 Arabidopsis thaliana chromosome 1 BAC F16M19 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176498.10.0scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLD7KU230.0D7KU23_ARALL; Scarecrow transcription factor family protein
STRINGAT1G63100.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55071521
MalvidsOGEM72962743
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  3. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  4. Lorkovic ZJ,Lopato S,Pexa M,Lehner R,Barta A
    Interactions of Arabidopsis RS domain containing cyclophilins with SR proteins and U1 and U11 small nuclear ribonucleoprotein-specific proteins suggest their involvement in pre-mRNA Splicing.
    J. Biol. Chem., 2004. 279(32): p. 33890-8
    [PMID:15166240]
  5. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  6. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  7. El Ouakfaoui S,Miki B
    The stability of the Arabidopsis transcriptome in transgenic plants expressing the marker genes nptII and uidA.
    Plant J., 2005. 41(6): p. 791-800
    [PMID:15743445]
  8. Lorkovic ZJ,Lehner R,Forstner C,Barta A
    Evolutionary conservation of minor U12-type spliceosome between plants and humans.
    RNA, 2005. 11(7): p. 1095-107
    [PMID:15987817]
  9. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  10. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]
  11. Borges F, et al.
    Comparative transcriptomics of Arabidopsis sperm cells.
    Plant Physiol., 2008. 148(2): p. 1168-81
    [PMID:18667720]
  12. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]