PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G62990.1
Common NameF16P17.16, IRX11, IXR11, KNAT7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 291aa    MW: 32908.1 Da    PI: 6.5649
Description KNOTTED-like homeobox of Arabidopsis thaliana 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G62990.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.71.7e-072412732254
                  SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   +yp+++++++L +++gL+ +q+ +WF N+R +
  AT1G62990.1 241 WPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 273
                  58*****************************87 PP

2ELK22.72.3e-08194215122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK +L++++++++ ++++E++
  AT1G62990.1 194 ELKLELKQGFKSRIEDVREEIM 215
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.1E-192771IPR005540KNOX1
PfamPF037902.9E-162970IPR005540KNOX1
SMARTSM012561.5E-2680135IPR005541KNOX2
PfamPF037916.0E-1984134IPR005541KNOX2
PROSITE profilePS512139.202194214IPR005539ELK domain
PROSITE profilePS5007111.823214277IPR001356Homeobox domain
SuperFamilySSF466892.44E-16216280IPR009057Homeodomain-like
SMARTSM003896.3E-11216281IPR001356Homeobox domain
CDDcd000862.96E-12217278No hitNo description
Gene3DG3DSA:1.10.10.604.9E-25221279IPR009057Homeodomain-like
PfamPF059203.2E-18234273IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000272anatomyprotoxylem
PO:0000293anatomyguard cell
PO:0005352anatomyxylem
PO:0005848anatomysecondary xylem
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MQEAALGMMG ATVGGDGDTA VVAEQNRQLK GEIATHPMYE QLLAAHVACL RVATPIDQLP  60
IIEAQLSQSH HLLRSYASTA VGYHHDRHEL DNFLAQYVMV LCSFKEQLQQ HVRVHAVEAV  120
MACREIENNL HSLTGATLGE GSGATMSEDE DDLPMDFSSD NSGVDFSGGH DMTGFGPLLP  180
TESERSLMER VRQELKLELK QGFKSRIEDV REEIMRKRRA GKLPGDTTTV LKNWWQQHCK  240
WPYPTEDDKA KLVEETGLQL KQINNWFINQ RKRNWHNNSH SLTSLKSKRK H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A5e-13217273864Homeobox protein PKNOX1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.701040.0root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO118782290.0
Genevisible261106_at0.0
Expression AtlasAT1G62990-
AtGenExpressAT1G62990-
ATTED-IIAT1G62990-
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain transcription factor of the Knotted family. May be involved in secondary cell wall biosynthesis. Mutants have moderately irregular xylem development. Expression of this gene is upregulated by SND1 and MYB46.
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Function -- GeneRIF ? help Back to Top
  1. KNAT7 forms a functional complex with OFP proteins to regulate aspects of secondary cell wall formation.
    [PMID: 21457372]
  2. KNAT7 is a negative regulator of secondary wall biosynthesis.
    [PMID: 22236040]
  3. BLH6 and KNAT7 bind to the REV promoter and repress REV expression.
    [PMID: 25490916]
  4. This study shows that OFP1 and OFP4 enhance the repression activity of BLH6, supporting a role for these OFPs as components of a putative multi-protein transcription regulatory complex containing BLH6 and KNAT7.
    [PMID: 26107719]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G62990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A), AT1G71930 (A), AT2G46770 (A), AT3G61910 (A), AT5G12870 (A), AT5G62380 (A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G62990
IntActSearch Q9FPQ8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G62990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0260590.0BT026059.1 Arabidopsis thaliana At1g62990 mRNA, complete cds.
GenBankAF3084510.0AF308451.1 Arabidopsis thaliana homeodomain transcription factor KNAT7 (KNAT7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564805.10.0homeobox protein knotted-1-like 7
SwissprotQ9FPQ80.0KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLR0GI400.0R0GI40_9BRAS; Uncharacterized protein
STRINGAT1G62990.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Representative plantOGRP16717148
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Bellaoui M, et al.
    The Arabidopsis BELL1 and KNOX TALE homeodomain proteins interact through a domain conserved between plants and animals.
    Plant Cell, 2001. 13(11): p. 2455-70
    [PMID:11701881]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  5. Ehlting J, et al.
    Global transcript profiling of primary stems from Arabidopsis thaliana identifies candidate genes for missing links in lignin biosynthesis and transcriptional regulators of fiber differentiation.
    Plant J., 2005. 42(5): p. 618-40
    [PMID:15918878]
  6. Brown DM,Zeef LA,Ellis J,Goodacre R,Turner SR
    Identification of novel genes in Arabidopsis involved in secondary cell wall formation using expression profiling and reverse genetics.
    Plant Cell, 2005. 17(8): p. 2281-95
    [PMID:15980264]
  7. Andersson-Gunner
    Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis.
    Plant J., 2006. 45(2): p. 144-65
    [PMID:16367961]
  8. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  9. Truernit E,Siemering KR,Hodge S,Grbic V,Haseloff J
    A map of KNAT gene expression in the Arabidopsis root.
    Plant Mol. Biol., 2006. 60(1): p. 1-20
    [PMID:16463096]
  10. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  11. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  12. Zhong R,Richardson EA,Ye ZH
    The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.
    Plant Cell, 2007. 19(9): p. 2776-92
    [PMID:17890373]
  13. Di Giacomo E, et al.
    Characterization of KNOX genes in Medicago truncatula.
    Plant Mol. Biol., 2008. 67(1-2): p. 135-50
    [PMID:18274864]
  14. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  15. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  16. Bhargava A,Mansfield SD,Hall HC,Douglas CJ,Ellis BE
    MYB75 functions in regulation of secondary cell wall formation in the Arabidopsis inflorescence stem.
    Plant Physiol., 2010. 154(3): p. 1428-38
    [PMID:20807862]
  17. Li E,Wang S,Liu Y,Chen JG,Douglas CJ
    OVATE FAMILY PROTEIN4 (OFP4) interaction with KNAT7 regulates secondary cell wall formation in Arabidopsis thaliana.
    Plant J., 2011. 67(2): p. 328-41
    [PMID:21457372]
  18. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  19. Wang S, et al.
    Arabidopsis ovate family proteins, a novel transcriptional repressor family, control multiple aspects of plant growth and development.
    PLoS ONE, 2011. 6(8): p. e23896
    [PMID:21886836]
  20. Zhong R,Ye ZH
    MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes.
    Plant Cell Physiol., 2012. 53(2): p. 368-80
    [PMID:22197883]
  21. Li E, et al.
    The Class II KNOX gene KNAT7 negatively regulates secondary wall formation in Arabidopsis and is functionally conserved in Populus.
    New Phytol., 2012. 194(1): p. 102-15
    [PMID:22236040]
  22. Bhargava A, et al.
    The interacting MYB75 and KNAT7 transcription factors modulate secondary cell wall deposition both in stems and seed coat in Arabidopsis.
    Planta, 2013. 237(5): p. 1199-211
    [PMID:23328896]
  23. Liu Y, et al.
    BEL1-LIKE HOMEODOMAIN6 and KNOTTED ARABIDOPSIS THALIANA7 interact and regulate secondary cell wall formation via repression of REVOLUTA.
    Plant Cell, 2014. 26(12): p. 4843-61
    [PMID:25490916]
  24. Voiniciuc C,Yang B,Schmidt MH,G
    Starting to gel: how Arabidopsis seed coat epidermal cells produce specialized secondary cell walls.
    Int J Mol Sci, 2015. 16(2): p. 3452-73
    [PMID:25658798]
  25. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  26. Liu Y,Douglas CJ
    A role for OVATE FAMILY PROTEIN1 (OFP1) and OFP4 in a BLH6-KNAT7 multi-protein complex regulating secondary cell wall formation in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(7): p. e1033126
    [PMID:26107719]