PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G62700.1
Common NameANAC026, F23N19.6, NAC026, VND5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 394aa    MW: 45585.5 Da    PI: 6.6392
Description Arabidopsis NAC domain containing protein 26
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G62700.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.92.7e-5571361129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeelv++yL+kkv++k++e+ ++ik+vd+yk+eP dL++  k+ +ee+ ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk+++  
  AT1G62700.1   7 VPPGFRFHPTDEELVDYYLRKKVASKRIEI-DIIKDVDLYKIEPCDLQElcKIGNEEQsEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYI- 102
                  69****************************.99**************954555554445**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  +++l+g++ktLvfykgrap+g+k+dW+mheyrle
  AT1G62700.1 103 RHSLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                  8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-595156IPR003441NAC domain
PROSITE profilePS5100558.0367156IPR003441NAC domain
PfamPF023651.1E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0071555Biological Processcell wall organization
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000039anatomyshoot axis vascular system
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0009046anatomyflower
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MNSFSQVPPG FRFHPTDEEL VDYYLRKKVA SKRIEIDIIK DVDLYKIEPC DLQELCKIGN  60
EEQSEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YIRHSLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETSEN GTPQEEGWVV CRVFKKKLAA TVRKMGDYHS SPSQHWYDDQ  180
LSFMASEIIS SSPRQFLPNH HYNRHHHQQT LPCGLNAFNN NNPNLQCKQE LELHYNQMVQ  240
HQQQNHHLRE SMFLQLPQLE SPTSNCNSDN NNNTRNISNL QKSSNISHEE QLQQGNQSFS  300
SLYYDQGVEQ MTTDWRVLDK FVASQLSNDE EAAAVVSSSS HQNNVKIDTR NTGYHVIDEG  360
INLPENDSER VVEMGEEYSN AHAASTSSSC QIDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-51715715169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184076390.0
Genevisible262689_at0.0
Expression AtlasAT1G62700-
AtGenExpressAT1G62700-
ATTED-IIAT1G62700-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Detected in root vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls. Expressed in roots, hypocotyls, cotyledons and leaves (PubMed:18445131). Expressed in developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC-domain transcription factor. Expressed in the vascular tissue.
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Function -- GeneRIF ? help Back to Top
  1. transactivation analysis revealed that VND1 to VND5 could activate expression of the GUS reporter gene driven by the secondary wall NAC binding element (SNBE).
    [PMID: 25148240]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G62700.1
Interaction ? help Back to Top
Source Intact With
IntActSearch F4HYV5
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G62700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0071900.0AC007190.4 Genomic sequence for Arabidopsis thaliana BAC F23N19 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176457.10.0NAC domain containing protein 26
SwissprotF4HYV50.0NAC26_ARATH; NAC domain-containing protein 26
TrEMBLR0GGE40.0R0GGE4_9BRAS; Uncharacterized protein
STRINGAT1G62700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21112678
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kubo M, et al.
    Transcription switches for protoxylem and metaxylem vessel formation.
    Genes Dev., 2005. 19(16): p. 1855-60
    [PMID:16103214]
  4. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  5. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  6. Yamaguchi M,Kubo M,Fukuda H,Demura T
    Vascular-related NAC-DOMAIN7 is involved in the differentiation of all types of xylem vessels in Arabidopsis roots and shoots.
    Plant J., 2008. 55(4): p. 652-64
    [PMID:18445131]
  7. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]
  8. Meng X, et al.
    A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.
    Plant Cell, 2012. 24(12): p. 4948-60
    [PMID:23263767]
  9. Zhou J,Zhong R,Ye ZH
    Arabidopsis NAC domain proteins, VND1 to VND5, are transcriptional regulators of secondary wall biosynthesis in vessels.
    PLoS ONE, 2014. 9(8): p. e105726
    [PMID:25148240]