PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G62360.1
Common NameBUM, BUM1, F2401.9, SHL, STM, WAM, WAM1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 382aa    MW: 42753.1 Da    PI: 6.6713
Description KNOX/ELK homeobox transcription factor
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G62360.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-093083422155
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  k +yps++++  LA+++gL+++q+ +WF N+R ++
  AT1G62360.1 308 KWPYPSEQQKLALAESTGLDQKQINNWFINQRKRH 342
                  569*****************************885 PP

2ELK413.9e-14262283122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLlrKYsgyLgsLkqEF+
  AT1G62360.1 262 ELKGQLLRKYSGYLGSLKQEFM 283
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.1E-20119163IPR005540KNOX1
PfamPF037901.8E-22121159IPR005540KNOX1
SMARTSM012563.9E-27170221IPR005541KNOX2
PfamPF037911.0E-20174219IPR005541KNOX2
SMARTSM011882.8E-8262283IPR005539ELK domain
PROSITE profilePS5121311.174262282IPR005539ELK domain
PfamPF037896.4E-11262283IPR005539ELK domain
PROSITE profilePS5007113.151282345IPR001356Homeobox domain
SMARTSM003895.3E-13284349IPR001356Homeobox domain
SuperFamilySSF466891.45E-19284360IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-28287347IPR009057Homeodomain-like
CDDcd000862.28E-12294346No hitNo description
PfamPF059203.4E-17302341IPR008422Homeobox KN domain
PROSITE patternPS000270320343IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009691Biological Processcytokinin biosynthetic process
GO:0009934Biological Processregulation of meristem structural organization
GO:0019827Biological Processstem cell population maintenance
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MESGSNSTSC PMAFAGDNSD GPMCPMMMMM PPIMTSHQHH GHDHQHQQQE HDGYAYQSHH  60
QQSSSLFLQS LAPPQGTKNK VASSSSPSSC APAYSLMEIH HNEIVAGGIN PCSSSSSSAS  120
VKAKIMAHPH YHRLLAAYVN CQKVGAPPEV VARLEEACSS AAAAAASMGP TGCLGEDPGL  180
DQFMEAYCEM LVKYEQELSK PFKEAMVFLQ RVECQFKSLS LSSPSSFSGY GETAIDRNNN  240
GSSEEEVDMN NEFVDPQAED RELKGQLLRK YSGYLGSLKQ EFMKKRKKGK LPKEARQQLL  300
DWWSRHYKWP YPSEQQKLAL AESTGLDQKQ INNWFINQRK RHWKPSEDMQ FVVMDATHPH  360
HYFMDNVLGN PFPMDHISST ML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277286LKQEFMKKRK
2283287KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.108010.0floral meristem| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864924810.0
Genevisible260632_at0.0
Expression AtlasAT1G62360-
AtGenExpressAT1G62360-
ATTED-IIAT1G62360-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed in early to mid-globular-stage embryos. In late globular stage, detected as a stripe running medially across the top of the embryo. In heart stage embryo, expression is restricted to a notch between the cotyledons, in both hypodermal and protoderm cells. In the bending-cotyledon stage, localized in the SAM, but disappears from the boundary region of cotyledon margins (BCM). In seedlings and adult plants found in all shoot apical meristems. In the inflorescence meristem, expression disappears as floral buds are initiated and reappears in the later floral meristem where it is found in the central portion of the developing gyneocium. Also detected in the L1 layer of embryo. {ECO:0000269|PubMed:10079219}.
UniprotTISSUE SPECIFICITY: Expressed in all four types of shoot apical meristems (SAM) i.e. in vegetative, axillary, inflorescence and floral.
Functional Description ? help Back to Top
Source Description
TAIRClass I knotted-like homeodomain protein that is required for shoot apical meristem (SAM) formation during embryogenesis and for SAM function throughout the lifetime of the plant. Functions by preventing incorporation of cells in the meristem center into differentiating organ primordia.
UniProtRequired for shoot apical meristem (SAM) formation during embryogenesis. Negatively regulates ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2 or LBD6). Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:11934861}.
Function -- GeneRIF ? help Back to Top
  1. STM is targeted into the nuclear compartment through heterodimerization with Bel1-like homeodomain partner proteins.
    [PMID: 16513846]
  2. Heterodimers with PENNYWISE or POUND-FOOLISH control floral specification, internode patterning and the maintenance of boundaries between initiating floral primordia and the inflorescence meristem.
    [PMID: 16741748]
  3. STM provides the critical KNOX function in the development of both vegetative and reproductive meristematic tissues.
    [PMID: 17461793]
  4. regulatory point of leaf development mediated through a conserved, noncoding sequence in STM genes.
    [PMID: 17898165]
  5. the DNA-binding properties of the complex formed by the Arabidopsis TALE homeodomain (HD) proteins STM and BLH3
    [PMID: 19442701]
  6. The specification of flower and inflorescence meristems requires the combined activities of FT-FD and STM.
    [PMID: 20937733]
  7. The results bring new insights into the mechanistic links between KNOXI and CUC transcription factors and contribute to the understanding of the regulatory network controlled by STM.
    [PMID: 21685178]
  8. Data indicate that AtDOF4.2-overexpressing increased branching through the up-regulation of three branching-related genes, AtSTM (SHOOT MERISTEMLESS), AtTFL1 (TERMINAL FLOWER1) and AtCYP83B1 (CYTOCHROME P450 83B1).
    [PMID: 23095045]
  9. mediates the regulatory network of cell wall and lignin synthesis
    [PMID: 23242073]
  10. STM has dual cellular and meristem-organisational functions that are differentially represented in the class-1 KNOX gene family and have differing requirements for cytokinin (CK) and CYCD3.
    [PMID: 23573875]
  11. In the cambium, KNAT1 and STM, contrary to their function in the shoot apical meristem, promote cell differentiation through repression of BOP genes.
    [PMID: 25371365]
  12. The ELK domain has a role in the posttranslational regulation of STM by affecting the nuclear localization of STM.
    [PMID: 25524441]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G62360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G09770 (A), AT1G55580 (A), AT1G65620 (R), AT1G76420 (A), AT2G17950 (A), AT3G15170 (A), AT4G00180 (R), AT4G00220 (A), AT5G53950 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G23380(A), AT1G30040(A), AT1G30950(A), AT1G47990(A), AT1G65620(R), AT1G75820(A), AT1G76420(R), AT2G27250(A), AT2G37630(R), AT3G23630(A), AT3G48100(A), AT4G25420(R), AT5G19040(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDcytokinin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G62990, AT1G75410
IntActSearch Q38874
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G62360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU323440.0U32344.1 Arabidopsis thaliana Shootmeristemless (STM) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176426.10.0homeobox protein SHOOT MERISTEMLESS
SwissprotQ388740.0STM_ARATH; Homeobox protein SHOOT MERISTEMLESS
TrEMBLD7KUR50.0D7KUR5_ARALL; Putative uncharacterized protein
STRINGAT1G62360.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MalvidsOGEM64732644
Publications ? help Back to Top
  1. Aida M,Ishida T,Tasaka M
    Shoot apical meristem and cotyledon formation during Arabidopsis embryogenesis: interaction among the CUP-SHAPED COTYLEDON and SHOOT MERISTEMLESS genes.
    Development, 1999. 126(8): p. 1563-70
    [PMID:10079219]
  2. Rupp HM,Frank M,Werner T,Strnad M,Schm
    Increased steady state mRNA levels of the STM and KNAT1 homeobox genes in cytokinin overproducing Arabidopsis thaliana indicate a role for cytokinins in the shoot apical meristem.
    Plant J., 1999. 18(5): p. 557-63
    [PMID:10417706]
  3. Zondlo SC,Irish VF
    CYP78A5 encodes a cytochrome P450 that marks the shoot apical meristem boundary in Arabidopsis.
    Plant J., 1999. 19(3): p. 259-68
    [PMID:10476073]
  4. Speulman E, et al.
    A two-component enhancer-inhibitor transposon mutagenesis system for functional analysis of the Arabidopsis genome.
    Plant Cell, 1999. 11(10): p. 1853-66
    [PMID:10521517]
  5. Long J,Barton MK
    Initiation of axillary and floral meristems in Arabidopsis.
    Dev. Biol., 2000. 218(2): p. 341-53
    [PMID:10656774]
  6. Frank M, et al.
    Hormone autotrophic growth and differentiation identifies mutant lines of Arabidopsis with altered cytokinin and auxin content or signaling.
    Plant Physiol., 2000. 122(3): p. 721-9
    [PMID:10712535]
  7. Grbić V,Bleecker AB
    Axillary meristem development in Arabidopsis thaliana.
    Plant J., 2000. 21(2): p. 215-23
    [PMID:10743661]
  8. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  9. M
    The Arabidopsis PHD-finger protein SHL is required for proper development and fertility.
    Mol. Gen. Genet., 2000. 264(4): p. 363-70
    [PMID:11129039]
  10. Byrne ME, et al.
    Asymmetric leaves1 mediates leaf patterning and stem cell function in Arabidopsis.
    Nature, 2000 Dec 21-28. 408(6815): p. 967-71
    [PMID:11140682]
  11. Otsuga D,DeGuzman B,Prigge MJ,Drews GN,Clark SE
    REVOLUTA regulates meristem initiation at lateral positions.
    Plant J., 2001. 25(2): p. 223-36
    [PMID:11169198]
  12. Takada S,Hibara K,Ishida T,Tasaka M
    The CUP-SHAPED COTYLEDON1 gene of Arabidopsis regulates shoot apical meristem formation.
    Development, 2001. 128(7): p. 1127-35
    [PMID:11245578]
  13. Tsiantis M
    Control of shoot cell fate: beyond homeoboxes.
    Plant Cell, 2001. 13(4): p. 733-8
    [PMID:11283332]
  14. Semiarti E, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana regulates formation of a symmetric lamina, establishment of venation and repression of meristem-related homeobox genes in leaves.
    Development, 2001. 128(10): p. 1771-83
    [PMID:11311158]
  15. J
    Apical-basal pattern formation in Arabidopsis embryogenesis.
    EMBO J., 2001. 20(14): p. 3609-16
    [PMID:11447101]
  16. Teo WL,Kumar P,Goh CJ,Swarup S
    The expression of Brostm, a KNOTTED1-like gene, marks the cell type and timing of in vitro shoot induction in Brassica oleracea.
    Plant Mol. Biol., 2001. 46(5): p. 567-80
    [PMID:11516150]
  17. Bellaoui M, et al.
    The Arabidopsis BELL1 and KNOX TALE homeodomain proteins interact through a domain conserved between plants and animals.
    Plant Cell, 2001. 13(11): p. 2455-70
    [PMID:11701881]
  18. Pilu R, et al.
    Mutations in two independent genes lead to suppression of the shoot apical meristem in maize.
    Plant Physiol., 2002. 128(2): p. 502-11
    [PMID:11842154]
  19. Byrne ME,Simorowski J,Martienssen RA
    ASYMMETRIC LEAVES1 reveals knox gene redundancy in Arabidopsis.
    Development, 2002. 129(8): p. 1957-65
    [PMID:11934861]
  20. Mordhorst AP,Hartog MV,El Tamer MK,Laux T,de Vries SC
    Somatic embryogenesis from Arabidopsis shoot apical meristem mutants.
    Planta, 2002. 214(6): p. 829-36
    [PMID:11941458]
  21. Sharma VK,Fletcher JC
    Maintenance of shoot and floral meristem cell proliferation and fate.
    Plant Physiol., 2002. 129(1): p. 31-9
    [PMID:12011335]
  22. Devadas SK,Enyedi A,Raina R
    The Arabidopsis hrl1 mutation reveals novel overlapping roles for salicylic acid, jasmonic acid and ethylene signalling in cell death and defence against pathogens.
    Plant J., 2002. 30(4): p. 467-80
    [PMID:12028576]
  23. Golz JF,Hudson A
    Signalling in plant lateral organ development.
    Plant Cell, 2002. 14 Suppl: p. S277-88
    [PMID:12045283]
  24. Long JA,Woody S,Poethig S,Meyerowitz EM,Barton MK
    Transformation of shoots into roots in Arabidopsis embryos mutant at the TOPLESS locus.
    Development, 2002. 129(12): p. 2797-806
    [PMID:12050130]
  25. Frank M, et al.
    Tumorous shoot development (TSD) genes are required for co-ordinated plant shoot development.
    Plant J., 2002. 29(1): p. 73-85
    [PMID:12060228]
  26. Brand U,Grünewald M,Hobe M,Simon R
    Regulation of CLV3 expression by two homeobox genes in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 565-75
    [PMID:12068101]
  27. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  28. Lenhard M,Jürgens G,Laux T
    The WUSCHEL and SHOOTMERISTEMLESS genes fulfil complementary roles in Arabidopsis shoot meristem regulation.
    Development, 2002. 129(13): p. 3195-206
    [PMID:12070094]
  29. Gallois JL,Woodward C,Reddy GV,Sablowski R
    Combined SHOOT MERISTEMLESS and WUSCHEL trigger ectopic organogenesis in Arabidopsis.
    Development, 2002. 129(13): p. 3207-17
    [PMID:12070095]
  30. Aida M,Vernoux T,Furutani M,Traas J,Tasaka M
    Roles of PIN-FORMED1 and MONOPTEROS in pattern formation of the apical region of the Arabidopsis embryo.
    Development, 2002. 129(17): p. 3965-74
    [PMID:12163400]
  31. Kalinina A,Mihajlović N,Grbić V
    Axillary meristem development in the branchless Zu-0 ecotype of Arabidopsis thaliana.
    Planta, 2002. 215(5): p. 699-707
    [PMID:12244434]
  32. Hay A, et al.
    The gibberellin pathway mediates KNOTTED1-type homeobox function in plants with different body plans.
    Curr. Biol., 2002. 12(18): p. 1557-65
    [PMID:12372247]
  33. Barley R,Waites R
    Plant meristems: the interplay of KNOX and gibberellins.
    Curr. Biol., 2002. 12(20): p. R696-8
    [PMID:12401187]
  34. Markel H,Chandler J,Werr W
    Translational fusions with the engrailed repressor domain efficiently convert plant transcription factors into dominant-negative functions.
    Nucleic Acids Res., 2002. 30(21): p. 4709-19
    [PMID:12409462]
  35. Kumaran MK,Bowman JL,Sundaresan V
    YABBY polarity genes mediate the repression of KNOX homeobox genes in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2761-70
    [PMID:12417699]
  36. Ha CM, et al.
    The BLADE-ON-PETIOLE 1 gene controls leaf pattern formation through the modulation of meristematic activity in Arabidopsis.
    Development, 2003. 130(1): p. 161-72
    [PMID:12441300]
  37. Cary AJ,Che P,Howell SH
    Developmental events and shoot apical meristem gene expression patterns during shoot development in Arabidopsis thaliana.
    Plant J., 2002. 32(6): p. 867-77
    [PMID:12492830]
  38. Takada S,Tasaka M
    Embryonic shoot apical meristem formation in higher plants.
    J. Plant Res., 2002. 115(6): p. 411-7
    [PMID:12579444]
  39. Micol JL,Hake S
    The development of plant leaves.
    Plant Physiol., 2003. 131(2): p. 389-94
    [PMID:12586863]
  40. Daimon Y,Takabe K,Tasaka M
    The CUP-SHAPED COTYLEDON genes promote adventitious shoot formation on calli.
    Plant Cell Physiol., 2003. 44(2): p. 113-21
    [PMID:12610213]
  41. Kirch T,Simon R,Grünewald M,Werr W
    The DORNROSCHEN/ENHANCER OF SHOOT REGENERATION1 gene of Arabidopsis acts in the control of meristem ccll fate and lateral organ development.
    Plant Cell, 2003. 15(3): p. 694-705
    [PMID:12615942]
  42. Greb T, et al.
    Molecular analysis of the LATERAL SUPPRESSOR gene in Arabidopsis reveals a conserved control mechanism for axillary meristem formation.
    Genes Dev., 2003. 17(9): p. 1175-87
    [PMID:12730136]
  43. Vroemen CW,Mordhorst AP,Albrecht C,Kwaaitaal MA,de Vries SC
    The CUP-SHAPED COTYLEDON3 gene is required for boundary and shoot meristem formation in Arabidopsis.
    Plant Cell, 2003. 15(7): p. 1563-77
    [PMID:12837947]
  44. Harrar Y,Bellec Y,Bellini C,Faure JD
    Hormonal control of cell proliferation requires PASTICCINO genes.
    Plant Physiol., 2003. 132(3): p. 1217-27
    [PMID:12857804]
  45. Byrne ME,Groover AT,Fontana JR,Martienssen RA
    Phyllotactic pattern and stem cell fate are determined by the Arabidopsis homeobox gene BELLRINGER.
    Development, 2003. 130(17): p. 3941-50
    [PMID:12874117]
  46. Smith HM,Hake S
    The interaction of two homeobox genes, BREVIPEDICELLUS and PENNYWISE, regulates internode patterning in the Arabidopsis inflorescence.
    Plant Cell, 2003. 15(8): p. 1717-27
    [PMID:12897247]
  47. Kim JY,Yuan Z,Jackson D
    Developmental regulation and significance of KNOX protein trafficking in Arabidopsis.
    Development, 2003. 130(18): p. 4351-62
    [PMID:12900451]
  48. Lin WC,Shuai B,Springer PS
    The Arabidopsis LATERAL ORGAN BOUNDARIES-domain gene ASYMMETRIC LEAVES2 functions in the repression of KNOX gene expression and in adaxial-abaxial patterning.
    Plant Cell, 2003. 15(10): p. 2241-52
    [PMID:14508003]
  49. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  50. Hibara K,Takada S,Tasaka M
    CUC1 gene activates the expression of SAM-related genes to induce adventitious shoot formation.
    Plant J., 2003. 36(5): p. 687-96
    [PMID:14617069]
  51. Yang S,Yu H,Xu Y,Goh CJ
    Investigation of cytokinin-deficient phenotypes in Arabidopsis by ectopic expression of orchid DSCKX1.
    FEBS Lett., 2003. 555(2): p. 291-6
    [PMID:14644430]
  52. Deveaux Y, et al.
    The ethanol switch: a tool for tissue-specific gene induction during plant development.
    Plant J., 2003. 36(6): p. 918-30
    [PMID:14675455]
  53. Katz A,Oliva M,Mosquna A,Hakim O,Ohad N
    FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development.
    Plant J., 2004. 37(5): p. 707-19
    [PMID:14871310]
  54. Bhatt AM,Etchells JP,Canales C,Lagodienko A,Dickinson H
    VAAMANA--a BEL1-like homeodomain protein, interacts with KNOX proteins BP and STM and regulates inflorescence stem growth in Arabidopsis.
    Gene, 2004. 328: p. 103-11
    [PMID:15019989]
  55. Laux T,W
    Genetic regulation of embryonic pattern formation.
    Plant Cell, 2004. 16 Suppl: p. S190-202
    [PMID:15100395]
  56. Mauseth JD
    Giant shoot apical meristems in cacti have ordinary leaf primordia but altered phyllotaxy and shoot diameter.
    Ann. Bot., 2004. 94(1): p. 145-53
    [PMID:15145794]
  57. Mallory AC,Dugas DV,Bartel DP,Bartel B
    MicroRNA regulation of NAC-domain targets is required for proper formation and separation of adjacent embryonic, vegetative, and floral organs.
    Curr. Biol., 2004. 14(12): p. 1035-46
    [PMID:15202996]
  58. Cnops G, et al.
    The rotunda2 mutants identify a role for the LEUNIG gene in vegetative leaf morphogenesis.
    J. Exp. Bot., 2004. 55(402): p. 1529-39
    [PMID:15208345]
  59. Engstrom EM,Izhaki A,Bowman JL
    Promoter bashing, microRNAs, and Knox genes. New insights, regulators, and targets-of-regulation in the establishment of lateral organ polarity in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 685-94
    [PMID:15208415]
  60. Schrader J, et al.
    A high-resolution transcript profile across the wood-forming meristem of poplar identifies potential regulators of cambial stem cell identity.
    Plant Cell, 2004. 16(9): p. 2278-92
    [PMID:15316113]
  61. Carles CC,Lertpiriyapong K,Reville K,Fletcher JC
    The ULTRAPETALA1 gene functions early in Arabidopsis development to restrict shoot apical meristem activity and acts through WUSCHEL to regulate floral meristem determinacy.
    Genetics, 2004. 167(4): p. 1893-903
    [PMID:15342527]
  62. Furutani M, et al.
    PIN-FORMED1 and PINOID regulate boundary formation and cotyledon development in Arabidopsis embryogenesis.
    Development, 2004. 131(20): p. 5021-30
    [PMID:15371311]
  63. Kajiwara T,Furutani M,Hibara K,Tasaka M
    The GURKE gene encoding an acetyl-CoA carboxylase is required for partitioning the embryo apex into three subregions in Arabidopsis.
    Plant Cell Physiol., 2004. 45(9): p. 1122-8
    [PMID:15509834]
  64. Craft J, et al.
    New pOp/LhG4 vectors for stringent glucocorticoid-dependent transgene expression in Arabidopsis.
    Plant J., 2005. 41(6): p. 899-918
    [PMID:15743453]
  65. Wu X,Dabi T,Weigel D
    Requirement of homeobox gene STIMPY/WOX9 for Arabidopsis meristem growth and maintenance.
    Curr. Biol., 2005. 15(5): p. 436-40
    [PMID:15753038]
  66. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  67. Kidner CA,Martienssen RA
    The role of ARGONAUTE1 (AGO1) in meristem formation and identity.
    Dev. Biol., 2005. 280(2): p. 504-17
    [PMID:15882589]
  68. Jung JH,Yun J,Seo YH,Park CM
    Characterization of an Arabidopsis gene that mediates cytokinin signaling in shoot apical meristem development.
    Mol. Cells, 2005. 19(3): p. 342-9
    [PMID:15995350]
  69. Groot EP,Sinha N,Gleissberg S
    Expression patterns of STM-like KNOX and Histone H4 genes in shoot development of the dissected-leaved basal eudicot plants Chelidonium majus and Eschscholzia californica (Papaveraceae).
    Plant Mol. Biol., 2005. 58(3): p. 317-31
    [PMID:16021398]
  70. Treml BS, et al.
    The gene ENHANCER OF PINOID controls cotyledon development in the Arabidopsis embryo.
    Development, 2005. 132(18): p. 4063-74
    [PMID:16107478]
  71. Jasinski S, et al.
    KNOX action in Arabidopsis is mediated by coordinate regulation of cytokinin and gibberellin activities.
    Curr. Biol., 2005. 15(17): p. 1560-5
    [PMID:16139211]
  72. Yanai O, et al.
    Arabidopsis KNOXI proteins activate cytokinin biosynthesis.
    Curr. Biol., 2005. 15(17): p. 1566-71
    [PMID:16139212]
  73. Ledbedeva OV,Ezhova TA,Melzer S
    [Gene TAENIATA is a novel negative regulator of the Arabidopsis thaliana homeobox genes KNAT1, KNAT2, KNAT6, and STM].
    Genetika, 2005. 41(8): p. 1068-74
    [PMID:16161627]
  74. Hudson A
    Plant meristems: mobile mediators of cell fate.
    Curr. Biol., 2005. 15(19): p. R803-5
    [PMID:16213812]
  75. Grigg SP,Canales C,Hay A,Tsiantis M
    SERRATE coordinates shoot meristem function and leaf axial patterning in Arabidopsis.
    Nature, 2005. 437(7061): p. 1022-6
    [PMID:16222298]
  76. Müller D,Schmitz G,Theres K
    Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis.
    Plant Cell, 2006. 18(3): p. 586-97
    [PMID:16461581]
  77. Keller T,Abbott J,Moritz T,Doerner P
    Arabidopsis REGULATOR OF AXILLARY MERISTEMS1 controls a leaf axil stem cell niche and modulates vegetative development.
    Plant Cell, 2006. 18(3): p. 598-611
    [PMID:16473968]
  78. Cole M,Nolte C,Werr W
    Nuclear import of the transcription factor SHOOT MERISTEMLESS depends on heterodimerization with BLH proteins expressed in discrete sub-domains of the shoot apical meristem of Arabidopsis thaliana.
    Nucleic Acids Res., 2006. 34(4): p. 1281-92
    [PMID:16513846]
  79. Kanrar S,Onguka O,Smith HM
    Arabidopsis inflorescence architecture requires the activities of KNOX-BELL homeodomain heterodimers.
    Planta, 2006. 224(5): p. 1163-73
    [PMID:16741748]
  80. Belles-Boix E, et al.
    KNAT6: an Arabidopsis homeobox gene involved in meristem activity and organ separation.
    Plant Cell, 2006. 18(8): p. 1900-7
    [PMID:16798887]
  81. Groover AT, et al.
    The Populus homeobox gene ARBORKNOX1 reveals overlapping mechanisms regulating the shoot apical meristem and the vascular cambium.
    Plant Mol. Biol., 2006. 61(6): p. 917-32
    [PMID:16927204]
  82. Schubert D, et al.
    Silencing by plant Polycomb-group genes requires dispersed trimethylation of histone H3 at lysine 27.
    EMBO J., 2006. 25(19): p. 4638-49
    [PMID:16957776]
  83. Hibara K, et al.
    Arabidopsis CUP-SHAPED COTYLEDON3 regulates postembryonic shoot meristem and organ boundary formation.
    Plant Cell, 2006. 18(11): p. 2946-57
    [PMID:17122068]
  84. Zluvova J,Nicolas M,Berger A,Negrutiu I,Mon
    Premature arrest of the male flower meristem precedes sexual dimorphism in the dioecious plant Silene latifolia.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(49): p. 18854-9
    [PMID:17132741]
  85. Imin N,Nizamidin M,Wu T,Rolfe BG
    Factors involved in root formation in Medicago truncatula.
    J. Exp. Bot., 2007. 58(3): p. 439-51
    [PMID:17158109]
  86. Chiu WH,Chandler J,Cnops G,Van Lijsebettens M,Werr W
    Mutations in the TORNADO2 gene affect cellular decisions in the peripheral zone of the shoot apical meristem of Arabidopsis thaliana.
    Plant Mol. Biol., 2007. 63(6): p. 731-44
    [PMID:17351828]
  87. Jouannic S,Collin M,Vidal B,Verdeil JL,Tregear JW
    A class I KNOX gene from the palm species Elaeis guineensis (Arecaceae) is associated with meristem function and a distinct mode of leaf dissection.
    New Phytol., 2007. 174(3): p. 551-68
    [PMID:17447911]
  88. Scofield S,Dewitte W,Murray JA
    The KNOX gene SHOOT MERISTEMLESS is required for the development of reproductive meristematic tissues in Arabidopsis.
    Plant J., 2007. 50(5): p. 767-81
    [PMID:17461793]
  89. Borghi L,Bureau M,Simon R
    Arabidopsis JAGGED LATERAL ORGANS is expressed in boundaries and coordinates KNOX and PIN activity.
    Plant Cell, 2007. 19(6): p. 1795-808
    [PMID:17557810]
  90. Yin XJ, et al.
    Ubiquitin lysine 63 chain forming ligases regulate apical dominance in Arabidopsis.
    Plant Cell, 2007. 19(6): p. 1898-911
    [PMID:17586653]
  91. Ha CM,Jun JH,Nam HG,Fletcher JC
    BLADE-ON-PETIOLE 1 and 2 control Arabidopsis lateral organ fate through regulation of LOB domain and adaxial-abaxial polarity genes.
    Plant Cell, 2007. 19(6): p. 1809-25
    [PMID:17601823]
  92. Belmonte MF,Tahir M,Schroeder D,Stasolla C
    Overexpression of HBK3, a class I KNOX homeobox gene, improves the development of Norway spruce (Picea abies) somatic embryos.
    J. Exp. Bot., 2007. 58(11): p. 2851-61
    [PMID:17617659]
  93. Lin Z, et al.
    AtCDC5 regulates the G2 to M transition of the cell cycle and is critical for the function of Arabidopsis shoot apical meristem.
    Cell Res., 2007. 17(9): p. 815-28
    [PMID:17768399]
  94. Welch D, et al.
    Arabidopsis JACKDAW and MAGPIE zinc finger proteins delimit asymmetric cell division and stabilize tissue boundaries by restricting SHORT-ROOT action.
    Genes Dev., 2007. 21(17): p. 2196-204
    [PMID:17785527]
  95. Gordon SP, et al.
    Pattern formation during de novo assembly of the Arabidopsis shoot meristem.
    Development, 2007. 134(19): p. 3539-48
    [PMID:17827180]
  96. Kumar R, et al.
    The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins.
    Plant Cell, 2007. 19(9): p. 2719-35
    [PMID:17873098]
  97. Uchida N,Townsley B,Chung KH,Sinha N
    Regulation of SHOOT MERISTEMLESS genes via an upstream-conserved noncoding sequence coordinates leaf development.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(40): p. 15953-8
    [PMID:17898165]
  98. Soucek P,Kl
    Involvement of hormones and KNOXI genes in early Arabidopsis seedling development.
    J. Exp. Bot., 2007. 58(13): p. 3797-810
    [PMID:17951601]
  99. Winter N,Kollwig G,Zhang S,Kragler F
    MPB2C, a microtubule-associated protein, regulates non-cell-autonomy of the homeodomain protein KNOTTED1.
    Plant Cell, 2007. 19(10): p. 3001-18
    [PMID:17965274]
  100. Depuydt S, et al.
    Modulation of the hormone setting by Rhodococcus fascians results in ectopic KNOX activation in Arabidopsis.
    Plant Physiol., 2008. 146(3): p. 1267-81
    [PMID:18184732]
  101. Tanaka M,Kato N,Nakayama H,Nakatani M,Takahata Y
    Expression of class I knotted1-like homeobox genes in the storage roots of sweetpotato (Ipomoea batatas).
    J. Plant Physiol., 2008. 165(16): p. 1726-35
    [PMID:18242774]
  102. Chandler J,Nardmann J,Werr W
    Plant development revolves around axes.
    Trends Plant Sci., 2008. 13(2): p. 78-84
    [PMID:18262821]
  103. Di Giacomo E, et al.
    Characterization of KNOX genes in Medicago truncatula.
    Plant Mol. Biol., 2008. 67(1-2): p. 135-50
    [PMID:18274864]
  104. Saiga S, et al.
    The Arabidopsis OBERON1 and OBERON2 genes encode plant homeodomain finger proteins and are required for apical meristem maintenance.
    Development, 2008. 135(10): p. 1751-9
    [PMID:18403411]
  105. Liu J, et al.
    Ectopic expression of soybean GmKNT1 in Arabidopsis results in altered leaf morphology and flower identity.
    J Genet Genomics, 2008. 35(7): p. 441-9
    [PMID:18640623]
  106. Gómez-Mena C,Sablowski R
    ARABIDOPSIS THALIANA HOMEOBOX GENE1 establishes the basal boundaries of shoot organs and controls stem growth.
    Plant Cell, 2008. 20(8): p. 2059-72
    [PMID:18757555]
  107. Atta R, et al.
    Pluripotency of Arabidopsis xylem pericycle underlies shoot regeneration from root and hypocotyl explants grown in vitro.
    Plant J., 2009. 57(4): p. 626-44
    [PMID:18980654]
  108. Tamaki H, et al.
    Identification of novel meristem factors involved in shoot regeneration through the analysis of temperature-sensitive mutants of Arabidopsis.
    Plant J., 2009. 57(6): p. 1027-39
    [PMID:19054368]
  109. Yu L,Patibanda V,Smith HM
    A novel role of BELL1-like homeobox genes, PENNYWISE and POUND-FOOLISH, in floral patterning.
    Planta, 2009. 229(3): p. 693-707
    [PMID:19082619]
  110. Lunde C,Hake S
    The interaction of knotted1 and thick tassel dwarf1 in vegetative and reproductive meristems of maize.
    Genetics, 2009. 181(4): p. 1693-7
    [PMID:19153258]
  111. Rutjens B, et al.
    Shoot apical meristem function in Arabidopsis requires the combined activities of three BEL1-like homeodomain proteins.
    Plant J., 2009. 58(4): p. 641-54
    [PMID:19175771]
  112. Viola IL,Gonzalez DH
    Binding properties of the complex formed by the Arabidopsis TALE homeodomain proteins STM and BLH3 to DNA containing single and double target sites.
    Biochimie, 2009. 91(8): p. 974-81
    [PMID:19442701]
  113. Koizumi A,Yamanaka K,Kawano S
    Carpel development in a floral mutant of dioecious Silene latifolia producing asexual and female-like flowers.
    J. Plant Physiol., 2009. 166(16): p. 1832-8
    [PMID:19457581]
  114. Mantegazza R,Tononi P,M
    WUS and STM homologs are linked to the expression of lateral dominance in the acaulescent Streptocarpus rexii (Gesneriaceae).
    Planta, 2009. 230(3): p. 529-42
    [PMID:19526368]
  115. Lee DK,Geisler M,Springer PS
    LATERAL ORGAN FUSION1 and LATERAL ORGAN FUSION2 function in lateral organ separation and axillary meristem formation in Arabidopsis.
    Development, 2009. 136(14): p. 2423-32
    [PMID:19542355]
  116. Scofield S,Dewitte W,Murray JA
    A model for Arabidopsis class-1 KNOX gene function.
    Plant Signal Behav, 2008. 3(4): p. 257-9
    [PMID:19704647]
  117. Mon
    Sex determination in plants.
    Plant Signal Behav, 2007. 2(3): p. 178-9
    [PMID:19704689]
  118. Chandler JW,Cole M,Werr W
    The role of DORNROESCHEN (DRN) and DRN-LIKE (DRNL) in Arabidopsis embryonic patterning.
    Plant Signal Behav, 2008. 3(1): p. 49-51
    [PMID:19704719]
  119. Bureau M,Simon R
    JLO regulates embryo patterning and organ initiation by controlling auxin transport.
    Plant Signal Behav, 2008. 3(2): p. 145-7
    [PMID:19704738]
  120. Krupkov
    Developmental consequences of the tumorous shoot development1 mutation, a novel allele of the cellulose-synthesizing KORRIGAN1 gene.
    Plant Mol. Biol., 2009. 71(6): p. 641-55
    [PMID:19826767]
  121. Ikezaki M, et al.
    Genetic networks regulated by ASYMMETRIC LEAVES1 (AS1) and AS2 in leaf development in Arabidopsis thaliana: KNOX genes control five morphological events.
    Plant J., 2010. 61(1): p. 70-82
    [PMID:19891706]
  122. Bao F,Azhakanandam S,Franks RG
    SEUSS and SEUSS-LIKE transcriptional adaptors regulate floral and embryonic development in Arabidopsis.
    Plant Physiol., 2010. 152(2): p. 821-36
    [PMID:20007451]
  123. Tabata R, et al.
    Arabidopsis auxin response factor6 and 8 regulate jasmonic acid biosynthesis and floral organ development via repression of class 1 KNOX genes.
    Plant Cell Physiol., 2010. 51(1): p. 164-75
    [PMID:20007966]
  124. Koizumi A, et al.
    Two separate pathways including SlCLV1, SlSTM and SlCUC that control carpel development in a bisexual mutant of Silene latifolia.
    Plant Cell Physiol., 2010. 51(2): p. 282-93
    [PMID:20064843]
  125. Kawamura E,Horiguchi G,Tsukaya H
    Mechanisms of leaf tooth formation in Arabidopsis.
    Plant J., 2010. 62(3): p. 429-41
    [PMID:20128880]
  126. Finlayson SA,Krishnareddy SR,Kebrom TH,Casal JJ
    Phytochrome regulation of branching in Arabidopsis.
    Plant Physiol., 2010. 152(4): p. 1914-27
    [PMID:20154098]
  127. Takano S,Niihama M,Smith HM,Tasaka M,Aida M
    gorgon, a novel missense mutation in the SHOOT MERISTEMLESS gene, impairs shoot meristem homeostasis in Arabidopsis.
    Plant Cell Physiol., 2010. 51(4): p. 621-34
    [PMID:20208065]
  128. De Smet I,Lau S,Mayer U,J
    Embryogenesis - the humble beginnings of plant life.
    Plant J., 2010. 61(6): p. 959-70
    [PMID:20409270]
  129. Belmonte M,Elhiti M,Waldner B,Stasolla C
    Depletion of cellular brassinolide decreases embryo production and disrupts the architecture of the apical meristems in Brassica napus microspore-derived embryos.
    J. Exp. Bot., 2010. 61(10): p. 2779-94
    [PMID:20435696]
  130. Gaamouche T, et al.
    Cyclin-dependent kinase activity maintains the shoot apical meristem cells in an undifferentiated state.
    Plant J., 2010. 64(1): p. 26-37
    [PMID:20659279]
  131. Smith HM,Ung N,Lal S,Courtier J
    Specification of reproductive meristems requires the combined function of SHOOT MERISTEMLESS and floral integrators FLOWERING LOCUS T and FD during Arabidopsis inflorescence development.
    J. Exp. Bot., 2011. 62(2): p. 583-93
    [PMID:20937733]
  132. Piazza P, et al.
    Arabidopsis thaliana leaf form evolved via loss of KNOX expression in leaves in association with a selective sweep.
    Curr. Biol., 2010. 20(24): p. 2223-8
    [PMID:21129970]
  133. Szakonyi D,Byrne ME
    Ribosomal protein L27a is required for growth and patterning in Arabidopsis thaliana.
    Plant J., 2011. 65(2): p. 269-81
    [PMID:21223391]
  134. Elhiti M,Stasolla C
    Ectopic expression of the Brassica SHOOTMERISTEMLESS attenuates the deleterious effects of the auxin transport inhibitor TIBA on somatic embryo number and morphology.
    Plant Sci., 2011. 180(2): p. 383-90
    [PMID:21421384]
  135. Szakonyi D,Byrne ME
    Involvement of ribosomal protein RPL27a in meristem activity and organ development.
    Plant Signal Behav, 2011. 6(5): p. 712-4
    [PMID:21448008]
  136. Hu W,Feng B,Ma H
    Ectopic expression of the Arabidopsis MINI ZINC FINGER1 and MIF3 genes induces shoot meristems on leaf margins.
    Plant Mol. Biol., 2011. 76(1-2): p. 57-68
    [PMID:21455630]
  137. Spinelli SV,Martin AP,Viola IL,Gonzalez DH,Palatnik JF
    A mechanistic link between STM and CUC1 during Arabidopsis development.
    Plant Physiol., 2011. 156(4): p. 1894-904
    [PMID:21685178]
  138. Durbak AR,Tax FE
    CLAVATA signaling pathway receptors of Arabidopsis regulate cell proliferation in fruit organ formation as well as in meristems.
    Genetics, 2011. 189(1): p. 177-94
    [PMID:21705761]
  139. Xu XM, et al.
    Chaperonins facilitate KNOTTED1 cell-to-cell trafficking and stem cell function.
    Science, 2011. 333(6046): p. 1141-4
    [PMID:21868675]
  140. Larsson E,Sitbon F,von Arnold S
    Differential regulation of Knotted1-like genes during establishment of the shoot apical meristem in Norway spruce (Picea abies).
    Plant Cell Rep., 2012. 31(6): p. 1053-60
    [PMID:22241731]
  141. Zhao L, et al.
    Roles for a soybean RAV-like orthologue in shoot regeneration and photoperiodicity inferred from transgenic plants.
    J. Exp. Bot., 2012. 63(8): p. 3257-70
    [PMID:22389516]
  142. Elhiti M,Stasolla C
    In vitro shoot organogenesis and hormone response are affected by the altered levels of Brassica napus meristem genes.
    Plant Sci., 2012. 190: p. 40-51
    [PMID:22608518]
  143. Rast MI,Simon R
    Arabidopsis JAGGED LATERAL ORGANS acts with ASYMMETRIC LEAVES2 to coordinate KNOX and PIN expression in shoot and root meristems.
    Plant Cell, 2012. 24(7): p. 2917-33
    [PMID:22822207]
  144. Alakonya A, et al.
    Interspecific RNA interference of SHOOT MERISTEMLESS-like disrupts Cuscuta pentagona plant parasitism.
    Plant Cell, 2012. 24(7): p. 3153-66
    [PMID:22822208]
  145. Z
    The class II HD-ZIP JAIBA gene is involved in meristematic activity and important for gynoecium and fruit development in Arabidopsis.
    Plant Signal Behav, 2012. 7(11): p. 1501-3
    [PMID:22951401]
  146. Zou HF, et al.
    The transcription factor AtDOF4.2 regulates shoot branching and seed coat formation in Arabidopsis.
    Biochem. J., 2013. 449(2): p. 373-88
    [PMID:23095045]
  147. Takagi N,Ueguchi C
    Enhancement of meristem formation by bouquet-1, a mis-sense allele of the vernalization independence 3 gene encoding a WD40 repeat protein in Arabidopsis thaliana.
    Genes Cells, 2012. 17(12): p. 982-93
    [PMID:23134555]
  148. Elhiti M, et al.
    Gene expression analysis in microdissected shoot meristems of Brassica napus microspore-derived embryos with altered SHOOTMERISTEMLESS levels.
    Planta, 2013. 237(4): p. 1065-82
    [PMID:23242073]
  149. Scofield S,Dewitte W,Nieuwland J,Murray JA
    The Arabidopsis homeobox gene SHOOT MERISTEMLESS has cellular and meristem-organisational roles with differential requirements for cytokinin and CYCD3 activity.
    Plant J., 2013. 75(1): p. 53-66
    [PMID:23573875]
  150. Stammler A, et al.
    Duplicated STM-like KNOX I genes act in floral meristem activity in Eschscholzia californica (Papaveraceae).
    Dev. Genes Evol., 2013. 223(5): p. 289-301
    [PMID:23636178]
  151. Liebsch D, et al.
    Class I KNOX transcription factors promote differentiation of cambial derivatives into xylem fibers in the Arabidopsis hypocotyl.
    Development, 2014. 141(22): p. 4311-9
    [PMID:25371365]
  152. Aguilar-Mart
    Transcriptional, posttranscriptional, and posttranslational regulation of SHOOT MERISTEMLESS gene expression in Arabidopsis determines gene function in the shoot apex.
    Plant Physiol., 2015. 167(2): p. 424-42
    [PMID:25524441]
  153. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  154. Long JA,Moan EI,Medford JI,Barton MK
    A member of the KNOTTED class of homeodomain proteins encoded by the STM gene of Arabidopsis.
    Nature, 1996. 379(6560): p. 66-9
    [PMID:8538741]
  155. Clark SE,Jacobsen SE,Levin JZ,Meyerowitz EM
    The CLAVATA and SHOOT MERISTEMLESS loci competitively regulate meristem activity in Arabidopsis.
    Development, 1996. 122(5): p. 1567-75
    [PMID:8625843]
  156. Chuck G,Lincoln C,Hake S
    KNAT1 induces lobed leaves with ectopic meristems when overexpressed in Arabidopsis.
    Plant Cell, 1996. 8(8): p. 1277-89
    [PMID:8776897]
  157. Liljegren SJ,Yanofsky MF
    Genetic control of shoot and flower meristem behavior.
    Curr. Opin. Cell Biol., 1996. 8(6): p. 865-9
    [PMID:8939670]
  158. Endrizzi K,Moussian B,Haecker A,Levin JZ,Laux T
    The SHOOT MERISTEMLESS gene is required for maintenance of undifferentiated cells in Arabidopsis shoot and floral meristems and acts at a different regulatory level than the meristem genes WUSCHEL and ZWILLE.
    Plant J., 1996. 10(6): p. 967-79
    [PMID:9011081]
  159. Laufs P,Dockx J,Kronenberger J,Traas J
    MGOUN1 and MGOUN2: two genes required for primordium initiation at the shoot apical and floral meristems in Arabidopsis thaliana.
    Development, 1998. 125(7): p. 1253-60
    [PMID:9477323]
  160. Moussian B,Schoof H,Haecker A,J
    Role of the ZWILLE gene in the regulation of central shoot meristem cell fate during Arabidopsis embryogenesis.
    EMBO J., 1998. 17(6): p. 1799-809
    [PMID:9501101]
  161. McConnell JR,Barton MK
    Leaf polarity and meristem formation in Arabidopsis.
    Development, 1998. 125(15): p. 2935-42
    [PMID:9655815]
  162. Long JA,Barton MK
    The development of apical embryonic pattern in Arabidopsis.
    Development, 1998. 125(16): p. 3027-35
    [PMID:9671577]
  163. Kayes JM,Clark SE
    CLAVATA2, a regulator of meristem and organ development in Arabidopsis.
    Development, 1998. 125(19): p. 3843-51
    [PMID:9729492]
  164. Lynn K, et al.
    The PINHEAD/ZWILLE gene acts pleiotropically in Arabidopsis development and has overlapping functions with the ARGONAUTE1 gene.
    Development, 1999. 126(3): p. 469-81
    [PMID:9876176]