PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G61730.1
Common NameT13M11.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 376aa    MW: 40879.7 Da    PI: 5.1753
Description DNA-binding storekeeper protein-related transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G61730.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573133.29.6e-42155245397
       DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  fqrlwseeDei++LqG+idfka+tgksp+ d++afy+f+kksisf+vsk+q+++Kir+L+kK+ +k+ +    +epsf k+hd+k+felsk iWg
  AT1G61730.1 155 FQRLWSEEDEILVLQGMIDFKADTGKSPYVDTNAFYDFLKKSISFEVSKNQFMDKIRSLRKKYIGKEGR----NEPSFVKAHDKKAFELSKFIWG 245
                  9********************************************************************....*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045047.3E-32155245IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MTKKLNPLED PPTATSSDED DVETSEAGEA SDDSSSSEED VPIKIRIKSP SATTAAAPPA  60
KSTAVSTAAD SDSGSETETD SDSESTNPPN SGSGKTIALN TVNLKKKEDP TSSSATLALP  120
AMKSGTKRPA SEAAATTSTK RVKKDEESVK KPGGFQRLWS EEDEILVLQG MIDFKADTGK  180
SPYVDTNAFY DFLKKSISFE VSKNQFMDKI RSLRKKYIGK EGRNEPSFVK AHDKKAFELS  240
KFIWGPKGIA LDSNVKSNGV SKKSVAKKKI DSVKQELVFA GGSSTNGKKV EEDGGDDGCD  300
WFDNSSLVRM IASLGVDEYY VKQQWSLVSV ESKKIVEEKY KLLQAKELEF VLEKTKFLNE  360
VASMFVEASK NKPLDT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.363890.0bud| flower| leaf| root| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425628680.0
Genevisible264398_at0.0
Expression AtlasAT1G61730-
AtGenExpressAT1G61730-
ATTED-IIAT1G61730-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G61730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G61730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0058820.0AC005882.1 Arabidopsis thaliana chromosome I BAC T13M11 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAK3175880.0AK317588.1 Arabidopsis thaliana AT1G61730 mRNA, complete cds, clone: RAFL05-19-E13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564784.10.0DNA-binding storekeeper protein-related transcriptional regulator
TrEMBLQ9SYA90.0Q9SYA9_ARATH; AT1G61730 protein
STRINGAT1G61730.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Representative plantOGRP4222523
Publications ? help Back to Top
  1. Curaba J,Herzog M,Vachon G
    GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1.
    Plant J., 2003. 33(2): p. 305-17
    [PMID:12535344]
  2. Kleffmann T, et al.
    The Arabidopsis thaliana chloroplast proteome reveals pathway abundance and novel protein functions.
    Curr. Biol., 2004. 14(5): p. 354-62
    [PMID:15028209]
  3. Pendle AF, et al.
    Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions.
    Mol. Biol. Cell, 2005. 16(1): p. 260-9
    [PMID:15496452]
  4. Sharma SB,Dixon RA
    Metabolic engineering of proanthocyanidins by ectopic expression of transcription factors in Arabidopsis thaliana.
    Plant J., 2005. 44(1): p. 62-75
    [PMID:16167896]
  5. de la Fuente van Bentem S, et al.
    Site-specific phosphorylation profiling of Arabidopsis proteins by mass spectrometry and peptide chip analysis.
    J. Proteome Res., 2008. 7(6): p. 2458-70
    [PMID:18433157]
  6. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  7. Jones AM, et al.
    Phosphoproteomic analysis of nuclei-enriched fractions from Arabidopsis thaliana.
    J Proteomics, 2009. 72(3): p. 439-51
    [PMID:19245862]
  8. Reiland S, et al.
    Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
    Plant Physiol., 2009. 150(2): p. 889-903
    [PMID:19376835]
  9. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  10. Waidmann S,Kusenda B,Mayerhofer J,Mechtler K,Jonak C
    A DEK domain-containing protein modulates chromatin structure and function in Arabidopsis.
    Plant Cell, 2014. 26(11): p. 4328-44
    [PMID:25387881]