PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G61110.1
Common Nameanac025, F11P17.16, NAC025, NAC25, TAPNAC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 323aa    MW: 36312.6 Da    PI: 8.1372
Description NAC domain containing protein 25
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G61110.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.4e-53161421128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++++ +++
  AT1G61110.1  16 LPPGFRFHPTDEELVVHYLKKKADSVPLPV-SIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSH 112
                  79****************************.89***************9888999******************************************* PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +vg+kk Lvfy g+ pkg ktdW+mheyrl
  AT1G61110.1 113 KVGVKKALVFYGGKPPKGIKTDWIMHEYRL 142
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-648178IPR003441NAC domain
PROSITE profilePS5100560.35916177IPR003441NAC domain
PfamPF023651.4E-2717142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MENMGDSSIG PGHPHLPPGF RFHPTDEELV VHYLKKKADS VPLPVSIIAE IDLYKFDPWE  60
LPSKASFGEH EWYFFSPRDR KYPNGVRPNR AATSGYWKAT GTDKPIFTCN SHKVGVKKAL  120
VFYGGKPPKG IKTDWIMHEY RLTDGNLSTA AKPPDLTTTR KNSLRLDDWV LCRIYKKNSS  180
QRPTMERVLL REDLMEGMLS KSSANSSSTS VLDNNDNNNN NNEEHFFDGM VVSSDKRSLC  240
GQYRMGHEAS GSSSFGSFLS SKRFHHTGDL NNDNYNVSFV SMLSEIPQSS GFHANGVMDT  300
TSSLADHGVL RQAFQLPNMN WHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-731618217170NO APICAL MERISTEM PROTEIN
1ut4_B3e-731618217170NO APICAL MERISTEM PROTEIN
1ut7_A3e-731618217170NO APICAL MERISTEM PROTEIN
1ut7_B3e-731618217170NO APICAL MERISTEM PROTEIN
3swm_A3e-731618020171NAC domain-containing protein 19
3swm_B3e-731618020171NAC domain-containing protein 19
3swm_C3e-731618020171NAC domain-containing protein 19
3swm_D3e-731618020171NAC domain-containing protein 19
3swp_A3e-731618020171NAC domain-containing protein 19
3swp_B3e-731618020171NAC domain-containing protein 19
3swp_C3e-731618020171NAC domain-containing protein 19
3swp_D3e-731618020171NAC domain-containing protein 19
4dul_A3e-731618217170NAC domain-containing protein 19
4dul_B3e-731618217170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.104300.0bud
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264882_at0.0
Expression AtlasAT1G61110-
AtGenExpressAT1G61110-
ATTED-IIAT1G61110-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during pollen development and maturation. {ECO:0000269|PubMed:21107887}.
UniprotTISSUE SPECIFICITY: Expressed specifically in the tapetum. {ECO:0000269|PubMed:21107887}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production.
Function -- GeneRIF ? help Back to Top
  1. Data show that a conserved TCGTGT motif was identified in the TAPNAC (At1g61110} promoter and other tapetal expressed promoters.
    [PMID: 21107887]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G61110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDBrassinosteroid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G61110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0083460.0BT008346.1 Arabidopsis thaliana At1g61110 mRNA, complete cds.
GenBankAK1178780.0AK117878.1 Arabidopsis thaliana At1g61110 mRNA for unknown protein, complete cds, clone: RAFL19-05-K20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564771.10.0NAC domain containing protein 25
SwissprotQ8GY420.0NAC25_ARATH; NAC transcription factor 25
TrEMBLD7KW470.0D7KW47_ARALL; ANAC025
STRINGAT1G61110.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  5. Wellmer F,Riechmann JL,Alves-Ferreira M,Meyerowitz EM
    Genome-wide analysis of spatial gene expression in Arabidopsis flowers.
    Plant Cell, 2004. 16(5): p. 1314-26
    [PMID:15100403]
  6. Kunieda T, et al.
    NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2631-42
    [PMID:18849494]
  7. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  8. Alvarado VY,Tag A,Thomas TL
    A cis regulatory element in the TAPNAC promoter directs tapetal gene expression.
    Plant Mol. Biol., 2011. 75(1-2): p. 129-39
    [PMID:21107887]