PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G59530.1
Common NameATBZIP4, bZIP4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 148aa    MW: 17234.6 Da    PI: 8.0399
Description basic leucine-zipper 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G59530.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1391.7e-124896351
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51
                 ++k+ rr ++NRe+A+rsR +Kk++ eeL+e+v  L   N++Lk++l +
  AT1G59530.1 48 DDKKRRRTISNRESAKRSRMKKKKRFEELTEEVNRLNIRNQELKNRLAN 96
                 589*****************************************77754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-1246117IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.6914897IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-124896No hitNo description
PfamPF001706.2E-104996IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-95097No hitNo description
PROSITE patternPS0003605368IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MFYTNMETVH NCFNDATITG DEIIDILAFL QSDESDNPSG INEVVPVDDK KRRRTISNRE  60
SAKRSRMKKK KRFEELTEEV NRLNIRNQEL KNRLANVVSC GNFISRENNR LKTESVCLEI  120
RLLELYRFLV AMQSPISTSV NYITTLEI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15171RRRTISNRESAKRSRMKKKKR
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257471_at0.0
Expression AtlasAT1G59530-
AtGenExpressAT1G59530-
ATTED-IIAT1G59530-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Function -- GeneRIF ? help Back to Top
  1. ZmbZIP4 is a positive regulator of plant abiotic stress responses and is involved in root development in maize.
    [PMID: 30126870]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G59530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G59530
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0093170.0AC009317.4 Genomic sequence for Arabidopsis thaliana BAC T30E16 from chromosome I, complete sequence.
GenBankAC0270360.0AC027036.12 Arabidopsis thaliana chromosome 1 BAC T4M14 genomic sequence, complete sequence.
GenBankAF4006190.0AF400619.1 Arabidopsis thaliana transcription factor-like protein bZIP4 mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176162.11e-104basic leucine-zipper 4
SwissprotQ9LQ651e-105BZIP4_ARATH; Basic leucine zipper 4
TrEMBLA0A178WN291e-101A0A178WN29_ARATH; BZIP4
STRINGAT1G59530.11e-103(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122322432
Representative plantOGRP1173246
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  4. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  5. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  6. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  7. Guo YL, et al.
    Genome-wide comparison of nucleotide-binding site-leucine-rich repeat-encoding genes in Arabidopsis.
    Plant Physiol., 2011. 157(2): p. 757-69
    [PMID:21810963]
  8. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  9. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  10. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  11. Ma H, et al.
    ZmbZIP4 Contributes to Stress Resistance in Maize by Regulating ABA Synthesis and Root Development.
    Plant Physiol., 2018. 178(2): p. 753-770
    [PMID:30126870]