PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G58110.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 374aa    MW: 42101 Da    PI: 9.789
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G58110.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.27.3e-082432801754
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  A+rsR RK+++i eLe+ v++L+ae ++   el+ l++
  AT1G58110.2 243 AQRSRVRKLQYISELERNVQTLQAEGSKVSAELDFLNQ 280
                  89*************************99999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0052232291IPR004827Basic-leucine zipper domain
CDDcd147038.20E-15235282No hitNo description
SuperFamilySSF579591.24E-5243285No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-5243283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MASSKGSQSV RNLMYPGKHA LLPPKIPFPS VSASYSEYIP TGLIGSRHGQ KLSNEKTHHQ  60
RTSSESHLVE ELPFWLDDLL NEQPESPARK CGHRRSSSDS YAYLDVANAT NISLTLQNDF  120
SYRNTVLSTQ RGVQELDRNK NAQDAAFYSG ASFLKQKSRQ RDSLVATGAC PSWLPFAREN  180
GGGKNLGALY MSQDATVISS ERKNYAEPFS HDPKMLSSEE NNSNPSPVTY EADNTKRAKQ  240
QFAQRSRVRK LQYISELERN VQTLQAEGSK VSAELDFLNQ RNLILSMENK ALKKRLESIA  300
QEKLIKQLEQ EVLEKEIGRL RALYQQQQQT QKPSASRGRA TSKDLDSQFS SLSLNTKDSN  360
CRRDSVSVMG QFHF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.369261e-122flower| inflorescence| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246399_at1e-142
Expression AtlasAT1G58110-
AtGenExpressAT1G58110-
ATTED-IIAT1G58110-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G58110.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G58110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0039800.0BT003980.1 Arabidopsis thaliana clone RAFL15-22-D03 (R20596) putative bZIP family transcription factor (At1g58110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031205.10.0Basic-leucine zipper (bZIP) transcription factor family protein
RefseqNP_176108.30.0Basic-leucine zipper (bZIP) transcription factor family protein
TrEMBLF4I9R10.0F4I9R1_ARATH; BZIP transcription factor-like protein
STRINGAT1G58110.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]