PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G55950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 203aa    MW: 23413.6 Da    PI: 8.601
Description DNA-binding storekeeper protein-related transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G55950.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57392.54.6e-29118194179
       DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkeps 79 
                  k+fqr+ s++D+ivlLqG++df++++g+ ++dd+++f+++vk+ isf+++++q+++KirrLK+Kf +k++k    +e+s
  AT1G55950.1 118 KYFQRILSDDDKIVLLQGMVDFQNDKGTISYDDMTGFIDTVKNIISFQANSRQFTTKIRRLKDKFVQKRNK--GVDENS 194
                  68********************************************************************9..444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-17120190IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MAKKNKRSQQ KNKCLKPEKD PSTVKRLLED PPRKKRYLQP LENPPTESYG DDEKMETEEE  60
GEKYLGKNLP ASAFIIVAAE RHDSDSYSET ELEKKICGSV VVAKMNDDKM VSTDTKKKYF  120
QRILSDDDKI VLLQGMVDFQ NDKGTISYDD MTGFIDTVKN IISFQANSRQ FTTKIRRLKD  180
KFVQKRNKGV DENSLANVEI YEI
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184056160.0
Genevisible260600_at0.0
Expression AtlasAT1G55950-
AtGenExpressAT1G55950-
ATTED-IIAT1G55950-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G55950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G55950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0023040.0AC002304.3 Genomic sequence for Arabidopsis thaliana BAC F14J16 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_175991.11e-148DNA-binding storekeeper protein-related transcriptional regulator
TrEMBLQ9LG151e-148Q9LG15_ARATH; DNA-binding storekeeper protein-related transcriptional regulator
STRINGAT1G55950.11e-148(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Representative plantOGRP4222523