PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G54330.1
Common NameANAC020, NAC020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 301aa    MW: 34768.9 Da    PI: 5.469
Description NAC domain containing protein 20
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G54330.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-5561331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeelv +yL +kv+g+ +el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rdkky++g+r+nrat++gyWkatgkd++v s k
  AT1G54330.1   6 LPPGFRFHPTDEELVAYYLDRKVNGQAIEL-EIIPEVDLYKCEPWDLPeKsFLPGNDMEWYFYSTRDKKYPNGSRTNRATRAGYWKATGKDRTVES-K 101
                  79****************************.99**************95334455788*************************************9.8 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  + ++g+kktLv+y+grap+g +t+Wvmheyrl
  AT1G54330.1 102 KMKMGMKKTLVYYRGRAPHGLRTNWVMHEYRL 133
                  999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-633153IPR003441NAC domain
PROSITE profilePS5100559.7116153IPR003441NAC domain
PfamPF023653.1E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKVNG QAIELEIIPE VDLYKCEPWD LPEKSFLPGN  60
DMEWYFYSTR DKKYPNGSRT NRATRAGYWK ATGKDRTVES KKMKMGMKKT LVYYRGRAPH  120
GLRTNWVMHE YRLTHAPSSS LKESYALCRV FKKNIQIPKR KGEEEEAEEE STSVGKEEEE  180
EKEKKWRKCD GNYIEDESLK RASAETSSSE LTQGVLLDEA NSSSIFALHF SSSLLDDHDH  240
LFSNYSHQLP YHPPLQLQDF PQLSMNEAEI MSIQQDFQCR DSMNGTLDEI FSSSATFPAS  300
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-55115412166NO APICAL MERISTEM PROTEIN
1ut4_B2e-55115412166NO APICAL MERISTEM PROTEIN
1ut7_A2e-55115412166NO APICAL MERISTEM PROTEIN
1ut7_B2e-55115412166NO APICAL MERISTEM PROTEIN
3swm_A2e-55115415169NAC domain-containing protein 19
3swm_B2e-55115415169NAC domain-containing protein 19
3swm_C2e-55115415169NAC domain-containing protein 19
3swm_D2e-55115415169NAC domain-containing protein 19
3swp_A2e-55115415169NAC domain-containing protein 19
3swp_B2e-55115415169NAC domain-containing protein 19
3swp_C2e-55115415169NAC domain-containing protein 19
3swp_D2e-55115415169NAC domain-containing protein 19
4dul_A2e-55115412166NAC domain-containing protein 19
4dul_B2e-55115412166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.372350.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible262999_at0.0
Expression AtlasAT1G54330-
AtGenExpressAT1G54330-
ATTED-IIAT1G54330-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G54330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G54330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1762780.0AK176278.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL23-20-J17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_175835.20.0NAC domain containing protein 20
SwissprotQ9FFI52e-83NAC86_ARATH; NAC domain-containing protein 86
TrEMBLQ67Z400.0Q67Z40_ARATH; NAC domain containing protein 20
STRINGAT1G54330.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM81232640
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  4. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]