PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G54160.1
Common NameF15I1.26, NFYA5, NF-YA5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YA
Protein Properties Length: 308aa    MW: 33773.7 Da    PI: 9.3612
Description nuclear factor Y, subunit A5
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G54160.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.61.8e-32177233158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +ep++VNaKQy++Il+RR++Rakle+++kl +k+rkpylheSRh hAl+R+RgsgGrF
  AT1G54160.1 177 NEPIFVNAKQYHAILRRRKHRAKLEAQNKL-IKCRKPYLHESRHLHALKRARGSGGRF 233
                  59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.3E-36175236IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.675176236IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.3E-27178233IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.8E-23179201IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860181201IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.8E-23210233IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000036anatomyleaf vascular system
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MQVFQRKEDS SWGNSMPTTN SNIQGSESFS LTKDMIMSTT QLPAMKHSGL QLQNQDSTSS  60
QSTEEESGGG EVASFGEYKR YGCSIVNNNL SGYIENLGKP IENYTKSITT SSMVSQDSVF  120
PAPTSGQISW SLQCAETSHF NGFLAPEYAS TPTALPHLEM MGLVSSRVPL PHHIQENEPI  180
FVNAKQYHAI LRRRKHRAKL EAQNKLIKCR KPYLHESRHL HALKRARGSG GRFLNTKKLQ  240
ESSNSLCSSQ MANGQNFSMS PHGGGSGIGS SSISPSSNSN CINMFQNPQF RFSGYPSTHH  300
ASALMSGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-19178238363NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.571600.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453367350.0
Genevisible263158_at0.0
Expression AtlasAT1G54160-
AtGenExpressAT1G54160-
ATTED-IIAT1G54160-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant, except roots. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:17322342}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the CCAAT-binding transcription factor (CBF-B/NF-YA) family. Expression is upregulated in response to ABA and drought. This regulation appears to be mediated by MIR169A which is downregulated in response to drought. NFYA5 is a target of MIR169A. Loss of function mutations are hypersensitive to drought.
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}.
Function -- GeneRIF ? help Back to Top
  1. Data show that NFYA5 is important for drought resistance, and its induction by drought stress occurs at both the transcriptional and posttranscriptional levels.
    [PMID: 18682547]
  2. these results provide evidence that NF-YA1, 5, 6, and 9 play redundant roles in male gametophyte development, embryogenesis, seed development, and post-germinative growth.
    [PMID: 22933713]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G54160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Altered response to blue light (BL) and abscisic acid (ABA). {ECO:0000269|PubMed:17322342}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G54160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3869570.0AF386957.1 Arabidopsis thaliana Unknown protein (F15I1.26) mRNA, complete cds.
GenBankAY0814450.0AY081445.1 Arabidopsis thaliana unknown protein (At1g54160) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_175818.10.0nuclear factor Y, subunit A5
SwissprotQ9SYH40.0NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLD7KLF30.0D7KLF3_ARALL; Predicted protein
STRINGAT1G54160.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116331733
Representative plantOGRP6801672
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
    [PMID:11250072]
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Sunkar R,Zhu JK
    Novel and stress-regulated microRNAs and other small RNAs from Arabidopsis.
    Plant Cell, 2004. 16(8): p. 2001-19
    [PMID:15258262]
  6. Lall S,Nettleton D,DeCook R,Che P,Howell SH
    Quantitative trait loci associated with adventitious shoot formation in tissue culture and the program of shoot development in Arabidopsis.
    Genetics, 2004. 167(4): p. 1883-92
    [PMID:15342526]
  7. Ronemus M,Vaughn MW,Martienssen RA
    MicroRNA-targeted and small interfering RNA-mediated mRNA degradation is regulated by argonaute, dicer, and RNA-dependent RNA polymerase in Arabidopsis.
    Plant Cell, 2006. 18(7): p. 1559-74
    [PMID:16798886]
  8. Xin Z,Mandaokar A,Chen J,Last RL,Browse J
    Arabidopsis ESK1 encodes a novel regulator of freezing tolerance.
    Plant J., 2007. 49(5): p. 786-99
    [PMID:17316173]
  9. Warpeha KM, et al.
    The GCR1, GPA1, PRN1, NF-Y signal chain mediates both blue light and abscisic acid responses in Arabidopsis.
    Plant Physiol., 2007. 143(4): p. 1590-600
    [PMID:17322342]
  10. Liu JX,Srivastava R,Che P,Howell SH
    Salt stress responses in Arabidopsis utilize a signal transduction pathway related to endoplasmic reticulum stress signaling.
    Plant J., 2007. 51(5): p. 897-909
    [PMID:17662035]
  11. Li WX, et al.
    The Arabidopsis NFYA5 transcription factor is regulated transcriptionally and posttranscriptionally to promote drought resistance.
    Plant Cell, 2008. 20(8): p. 2238-51
    [PMID:18682547]
  12. Yamamoto A, et al.
    Arabidopsis NF-YB subunits LEC1 and LEC1-LIKE activate transcription by interacting with seed-specific ABRE-binding factors.
    Plant J., 2009. 58(5): p. 843-56
    [PMID:19207209]
  13. Mu J,Tan H,Hong S,Liang Y,Zuo J
    Arabidopsis transcription factor genes NF-YA1, 5, 6, and 9 play redundant roles in male gametogenesis, embryogenesis, and seed development.
    Mol Plant, 2013. 6(1): p. 188-201
    [PMID:22933713]
  14. Leyva-Gonz
    Functional and transcriptome analysis reveals an acclimatization strategy for abiotic stress tolerance mediated by Arabidopsis NF-YA family members.
    PLoS ONE, 2012. 7(10): p. e48138
    [PMID:23118940]
  15. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  16. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  17. Gao W,Liu W,Zhao M,Li WX
    NERF encodes a RING E3 ligase important for drought resistance and enhances the expression of its antisense gene NFYA5 in Arabidopsis.
    Nucleic Acids Res., 2015. 43(1): p. 607-17
    [PMID:25514924]
  18. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  19. Nasim Z,Fahim M,Ahn JH
    Possible Role of MADS AFFECTING FLOWERING 3 and B-BOX DOMAIN PROTEIN 19 in Flowering Time Regulation of Arabidopsis Mutants with Defects in Nonsense-Mediated mRNA Decay.
    Front Plant Sci, 2017. 8: p. 191
    [PMID:28261246]
  20. Du Q,Zhao M,Gao W,Sun S,Li WX
    microRNA/microRNA* complementarity is important for the regulation pattern of NFYA5 by miR169 under dehydration shock in Arabidopsis.
    Plant J., 2017. 91(1): p. 22-33
    [PMID:28332758]
  21. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]