PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G52880.1
Common NameANAC018, ATNAM, F14G24.15, NAC018, NAM, NARS2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 320aa    MW: 35442.7 Da    PI: 8.5708
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G52880.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.17.1e-53171461128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk... 95 
                  lppGfrFhPtdeelv +yLk+k+++ +l++  +i++vd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+v+s+   
  AT1G52880.1  17 LPPGFRFHPTDEELVIHYLKRKADSVPLPV-AIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVISTggg 113
                  79****************************.88***************999999****************************************9998 PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++vg+kk Lvfy+g+ pkg+k+dW+mheyrl
  AT1G52880.1 114 GSKKVGVKKALVFYSGKPPKGVKSDWIMHEYRL 146
                  8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-6512178IPR003441NAC domain
PROSITE profilePS5100561.90717177IPR003441NAC domain
PfamPF023651.2E-2718146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MESTDSSGGP PPPQPNLPPG FRFHPTDEEL VIHYLKRKAD SVPLPVAIIA DVDLYKFDPW  60
ELPAKASFGE QEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVIST GGGGSKKVGV  120
KKALVFYSGK PPKGVKSDWI MHEYRLTDNK PTHICDFGNK KNSLRLDDWV LCRIYKKNNS  180
TASRHHHHLH HIHLDNDHHR HDMMIDDDRF RHVPPGLHFP AIFSDNNDPT AIYDGGGGGY  240
GGGSYSMNHC FASGSKQEQL FPPVMMMTSL NQDSGIGSSS SPSKRFNGGG VGDCSTSMAA  300
TPLMQNQGGI YQLPGLNWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-731618014171Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.110240.0flower| leaf| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306953670.0
Genevisible260156_at0.0
Expression AtlasAT1G52880-
AtGenExpressAT1G52880-
ATTED-IIAT1G52880-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Restricted primarily to the region of the embryo including the SAM (PubMed:12175016). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269|PubMed:12175016, ECO:0000269|PubMed:18849494}.
Functional Description ? help Back to Top
Source Description
TAIRTranscription factor with a NAC domain. Homologous to the petunia gene NAM which is required for the development of the shoot. Expressed in the embryo.
UniProtMay encode a transcription factor involved in the elaboration of shoot apical meristems (SAM) (Probable). Together with NAC056/NARS1, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Function -- GeneRIF ? help Back to Top
  1. NARS1/NAC2 and NARS2/NAM regulate embryogenesis by regulating the development and degeneration of ovule integuments.
    [PMID: 18849494]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00201DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G52880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT5G61850 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT5G61850(A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G53170, AT1G77450
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: When associated with disruption in NAC056/NARS1, abnormally shaped seeds, defect in embryogenesis arrested at the torpedo-shaped embryo stage, markedly delayed integuments degeneration, and delay of silique senescence. {ECO:0000269|PubMed:18849494}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G52880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1233110.0AF123311.1 Arabidopsis thaliana NAC domain protein NAM mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_175696.10.0NAC domain-containing protein 18
SwissprotQ9ZNU20.0NAC18_ARATH; NAC domain-containing protein 18
TrEMBLR0I6X80.0R0I6X8_9BRAS; Uncharacterized protein (Fragment)
STRINGAT1G52880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM19028276
Publications ? help Back to Top
  1. Kikuchi K, et al.
    Molecular analysis of the NAC gene family in rice.
    Mol. Gen. Genet., 2000. 262(6): p. 1047-51
    [PMID:10660065]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Duval M,Hsieh TF,Kim SY,Thomas TL
    Molecular characterization of AtNAM: a member of the Arabidopsis NAC domain superfamily.
    Plant Mol. Biol., 2002. 50(2): p. 237-48
    [PMID:12175016]
  4. Xie Q, et al.
    SINAT5 promotes ubiquitin-related degradation of NAC1 to attenuate auxin signals.
    Nature, 2002. 419(6903): p. 167-70
    [PMID:12226665]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  7. Zimmermann R,Werr W
    Pattern formation in the monocot embryo as revealed by NAM and CUC3 orthologues from Zea mays L.
    Plant Mol. Biol., 2005. 58(5): p. 669-85
    [PMID:16158242]
  8. Kim YS, et al.
    A membrane-bound NAC transcription factor regulates cell division in Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3132-44
    [PMID:17098812]
  9. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  10. Demura T,Fukuda H
    Transcriptional regulation in wood formation.
    Trends Plant Sci., 2007. 12(2): p. 64-70
    [PMID:17224301]
  11. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  12. Kunieda T, et al.
    NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2631-42
    [PMID:18849494]
  13. Blein T, et al.
    A conserved molecular framework for compound leaf development.
    Science, 2008. 322(5909): p. 1835-9
    [PMID:19095941]
  14. Yoshiyama K,Conklin PA,Huefner ND,Britt AB
    Suppressor of gamma response 1 (SOG1) encodes a putative transcription factor governing multiple responses to DNA damage.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(31): p. 12843-8
    [PMID:19549833]
  15. Kim SG,Park CM
    Membrane-mediated salt stress signaling in flowering time control.
    Plant Signal Behav, 2007. 2(6): p. 517-8
    [PMID:19704545]
  16. Yabuta Y, et al.
    Identification of recognition sequence of ANAC078 protein by the cyclic amplification and selection of targets technique.
    Plant Signal Behav, 2010. 5(6): p. 695-7
    [PMID:20404498]
  17. Wang H, et al.
    Mutation of WRKY transcription factors initiates pith secondary wall formation and increases stem biomass in dicotyledonous plants.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(51): p. 22338-43
    [PMID:21135241]
  18. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  19. Lee S,Park CM
    Regulation of reactive oxygen species generation under drought conditions in Arabidopsis.
    Plant Signal Behav, 2012. 7(6): p. 599-601
    [PMID:22580707]
  20. Li J, et al.
    miRNA164-directed cleavage of ZmNAC1 confers lateral root development in maize (Zea mays L.).
    BMC Plant Biol., 2012. 12: p. 220
    [PMID:23171309]
  21. Singh AK,Sharma V,Pal AK,Acharya V,Ahuja PS
    Genome-wide organization and expression profiling of the NAC transcription factor family in potato (Solanum tuberosum L.).
    DNA Res., 2013. 20(4): p. 403-23
    [PMID:23649897]
  22. Wei H,Yordanov YS,Georgieva T,Li X,Busov V
    Nitrogen deprivation promotes Populus root growth through global transcriptome reprogramming and activation of hierarchical genetic networks.
    New Phytol., 2013. 200(2): p. 483-97
    [PMID:23795675]
  23. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  24. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  25. Aida M,Ishida T,Fukaki H,Fujisawa H,Tasaka M
    Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant.
    Plant Cell, 1997. 9(6): p. 841-57
    [PMID:9212461]