PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G49720.1
Common NameABF1, AtABF1, BZIP35, F14J22.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 392aa    MW: 42727.6 Da    PI: 9.5497
Description abscisic acid responsive element-binding factor 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G49720.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.82.7e-14313364556
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  +r++r++kNRe+A rsR+RK+a++ eLe ++++L+  N++L+k+  e+ k+ 
  AT1G49720.1 313 RRQKRMIKNRESAARSRARKQAYTLELEAEIESLKLVNQDLQKKQAEIMKTH 364
                  79***************************************98877776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-14309374IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.117311362IPR004827Basic-leucine zipper domain
CDDcd147079.70E-23313363No hitNo description
Gene3DG3DSA:1.20.5.1704.0E-13313369No hitNo description
SuperFamilySSF579592.46E-10313363No hitNo description
PfamPF001704.2E-12313369IPR004827Basic-leucine zipper domain
PROSITE patternPS000360316331IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGTHIDINNL GGDTSRGNES KPLARQSSLY SLTFDELQST LGEPGKDFGS MNMDELLKNI  60
WTAEDTQAFM TTTSSVAAPG PSGFVPGGNG LQRQGSLTLP RTLSQKTVDE VWKYLNSKEG  120
SNGNTGTDAL ERQQTLGEMT LEDFLLRAGV VKEDNTQQNE NSSSGFYANN GAAGLEFGFG  180
QPNQNSISFN GNNSSMIMNQ APGLGLKVGG TMQQQQQPHQ QQLQQPHQRL PPTIFPKQAN  240
VTFAAPVNMV NRGLFETSAD GPANSNMGGA GGTVTATSPG TSSAENNTWS SPVPYVFGRG  300
RRSNTGLEKV VERRQKRMIK NRESAARSRA RKQAYTLELE AEIESLKLVN QDLQKKQAEI  360
MKTHNSELKE FSKQPPLLAK RQCLRRTLTG PW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.461870.0flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261613_at0.0
Expression AtlasAT1G49720-
AtGenExpressAT1G49720-
ATTED-IIAT1G49720-
Functional Description ? help Back to Top
Source Description
TAIRIdentified as a protein that binds to abscisic acid response elements. May mediate transcriptional regulation of ABA responses.
UniProtBinds to the ABA-responsive element (ABRE). Could participate in abscisic acid-regulated gene expression.
Function -- GeneRIF ? help Back to Top
  1. These studies on abscisic acid response element binding factor 1 (ABF1) gene in Arabidopsis demonstrate that it is required for seedling establishment during winter.
    [PMID: 21181499]
  2. ABF1 and ABF3 abundance is affected by ABA and KEG
    [PMID: 23742014]
  3. The four AREB/ABFs are the predominant transcription factors downstream of SRK2D/E/I in abscisic acid (ABA) signalling in response to osmotic stress during vegetative growth.
    [PMID: 24738645]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00087SELEX26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G49720.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by abscisic acid (ABA) and cold. {ECO:0000269|PubMed:10636868}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G49720
IntActSearch Q9M7Q5
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G49720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0935440.0AF093544.1 Arabidopsis thaliana clone 1 abscisic acid responsive elements-binding factor (ABRE) mRNA, complete cds.
GenBankBT0086470.0BT008647.1 Arabidopsis thaliana clone RAFL09-77-C02 (R19471) putative abscisic acid responsive elements-binding factor (At1g49720) mRNA, complete cds.
GenBankBT0085750.0BT008575.1 Arabidopsis thaliana clone U19471 putative abscisic acid responsive elements-binding factor (At1g49720) mRNA, complete cds.
GenBankAK2269830.0AK226983.1 Arabidopsis thaliana mRNA for abscisic acid responsive elements-binding factor, complete cds, clone: RAFL09-41-C22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564551.10.0abscisic acid-insensitive 5-like protein 4
SwissprotQ9M7Q50.0AI5L4_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 4
TrEMBLF4I3C90.0F4I3C9_ARATH; Abscisic acid responsive element-binding factor 1
STRINGAT1G49720.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Choi H,Hong J,Ha J,Kang J,Kim SY
    ABFs, a family of ABA-responsive element binding factors.
    J. Biol. Chem., 2000. 275(3): p. 1723-30
    [PMID:10636868]
  2. Finkelstein RR,Lynch TJ
    The Arabidopsis abscisic acid response gene ABI5 encodes a basic leucine zipper transcription factor.
    Plant Cell, 2000. 12(4): p. 599-609
    [PMID:10760247]
  3. Riechmann JL,Ratcliffe OJ
    A genomic perspective on plant transcription factors.
    Curr. Opin. Plant Biol., 2000. 3(5): p. 423-34
    [PMID:11019812]
  4. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  5. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  6. Finkelstein RR,Gampala SS,Rock CD
    Abscisic acid signaling in seeds and seedlings.
    Plant Cell, 2002. 14 Suppl: p. S15-45
    [PMID:12045268]
  7. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  8. Finkelstein R,Gampala SS,Lynch TJ,Thomas TL,Rock CD
    Redundant and distinct functions of the ABA response loci ABA-INSENSITIVE(ABI)5 and ABRE-BINDING FACTOR (ABF)3.
    Plant Mol. Biol., 2005. 59(2): p. 253-67
    [PMID:16247556]
  9. Choi HI, et al.
    Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity.
    Plant Physiol., 2005. 139(4): p. 1750-61
    [PMID:16299177]
  10. Fujii H,Verslues PE,Zhu JK
    Identification of two protein kinases required for abscisic acid regulation of seed germination, root growth, and gene expression in Arabidopsis.
    Plant Cell, 2007. 19(2): p. 485-94
    [PMID:17307925]
  11. Zhu SY, et al.
    Two calcium-dependent protein kinases, CPK4 and CPK11, regulate abscisic acid signal transduction in Arabidopsis.
    Plant Cell, 2007. 19(10): p. 3019-36
    [PMID:17921317]
  12. Garcia ME,Lynch T,Peeters J,Snowden C,Finkelstein R
    A small plant-specific protein family of ABI five binding proteins (AFPs) regulates stress response in germinating Arabidopsis seeds and seedlings.
    Plant Mol. Biol., 2008. 67(6): p. 643-58
    [PMID:18484180]
  13. Kline KG,Barrett-Wilt GA,Sussman MR
    In planta changes in protein phosphorylation induced by the plant hormone abscisic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(36): p. 15986-91
    [PMID:20733066]
  14. Sharma PD,Singh N,Ahuja PS,Reddy TV
    Abscisic acid response element binding factor 1 is required for establishment of Arabidopsis seedlings during winter.
    Mol. Biol. Rep., 2011. 38(8): p. 5147-59
    [PMID:21181499]
  15. Lalonde S, et al.
    A membrane protein/signaling protein interaction network for Arabidopsis version AMPv2.
    Front Physiol, 2010. 1: p. 24
    [PMID:21423366]
  16. Zhao R, et al.
    The Arabidopsis Ca(2+) -dependent protein kinase CPK12 negatively regulates abscisic acid signaling in seed germination and post-germination growth.
    New Phytol., 2011. 192(1): p. 61-73
    [PMID:21692804]
  17. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  18. Zhao R,Wang XF,Zhang DP
    CPK12: A Ca2+-dependent protein kinase balancer in abscisic acid signaling.
    Plant Signal Behav, 2011. 6(11): p. 1687-90
    [PMID:22041934]
  19. Lynch T,Erickson BJ,Finkelstein RR
    Direct interactions of ABA-insensitive(ABI)-clade protein phosphatase(PP)2Cs with calcium-dependent protein kinases and ABA response element-binding bZIPs may contribute to turning off ABA response.
    Plant Mol. Biol., 2012. 80(6): p. 647-58
    [PMID:23007729]
  20. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  21. Chen YT,Liu H,Stone S,Callis J
    ABA and the ubiquitin E3 ligase KEEP ON GOING affect proteolysis of the Arabidopsis thaliana transcription factors ABF1 and ABF3.
    Plant J., 2013. 75(6): p. 965-76
    [PMID:23742014]
  22. Lim S, et al.
    ABA-insensitive3, ABA-insensitive5, and DELLAs Interact to activate the expression of SOMNUS and other high-temperature-inducible genes in imbibed seeds in Arabidopsis.
    Plant Cell, 2013. 25(12): p. 4863-78
    [PMID:24326588]
  23. Yoshida T, et al.
    Four Arabidopsis AREB/ABF transcription factors function predominantly in gene expression downstream of SnRK2 kinases in abscisic acid signalling in response to osmotic stress.
    Plant Cell Environ., 2015. 38(1): p. 35-49
    [PMID:24738645]