PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G49560.1
Common NameF14J22.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 333aa    MW: 37381.5 Da    PI: 7.906
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G49560.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.42.4e-31192247156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rFv+a++qLGG+ +AtPk+i+e+m+ +gLt+++vkSHLQkYRl+
  AT1G49560.1 192 KQRRCWNPELHRRFVDALQQLGGPGVATPKQIREHMQEEGLTNDEVKSHLQKYRLH 247
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.368189249IPR017930Myb domain
SuperFamilySSF466899.86E-17190250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-27191250IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-25192247IPR006447Myb domain, plants
PfamPF002494.7E-8194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000191anatomysynergid
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGSLGDELSL GSIFGRGVSM NVVAVEKVDE HVKKLEEEKR KLESCQLELP LSLQILNDAI  60
LYLKDKRCSE METQPLLKDF ISVNKPIQGE RGIELLKREE LMREKKFQQW KANDDHTSKI  120
KSKLEIKRNE EKSPMLLIPK VETGLGLGLS SSSIRRKGIV ASCGFTSNSM PQPPTPAVPQ  180
QPAFLKQQAL RKQRRCWNPE LHRRFVDALQ QLGGPGVATP KQIREHMQEE GLTNDEVKSH  240
LQKYRLHIRK PNSNAEKQSA VVLGFNLWNS SAQDEEETCE GGESLKRSNA QSDSPQGPLQ  300
LPSTTTTTGG DSSMEDVEDA KSESFQLERL RSP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1282287ESLKRS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453365550.0
Genevisible261610_at0.0
Expression AtlasAT1G49560-
AtGenExpressAT1G49560-
ATTED-IIAT1G49560-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G49560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G49560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2216310.0AK221631.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL07-96-G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564549.10.0Homeodomain-like superfamily protein
SwissprotQ9FX840.0HHO6_ARATH; Transcription factor HHO6
TrEMBLA0A178WF130.0A0A178WF13_ARATH; Uncharacterized protein
STRINGAT1G49560.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139271824
Representative plantOGRP25631133
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rajagopalan R,Vaucheret H,Trejo J,Bartel DP
    A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana.
    Genes Dev., 2006. 20(24): p. 3407-25
    [PMID:17182867]
  3. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  4. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  5. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]