PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G49130.1
Common NameBBX17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 326aa    MW: 38316.8 Da    PI: 6.4337
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G49130.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.98.6e-082466238
     zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                 ++r C+++ +k++ ++C +++ +lC+ C ++ H+       H+
  AT1G49130.1 24 QPRACELCLNKHAVWYCASDDAFLCHVCDESVHSAnhvatkHE 66
                 7899*****************************6575556665 PP

2CCT67.43.9e-23278321144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea++ RY++Krk+R+FeKkirYe+RK++A++RpR+KGrFv+++
  AT1G49130.1 278 REARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRS 321
                  9****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.0962370IPR000315B-box-type zinc finger
SMARTSM003364.6E-92370IPR000315B-box-type zinc finger
PfamPF006431.9E-62467IPR000315B-box-type zinc finger
CDDcd000218.08E-102670No hitNo description
PfamPF062031.0E-17278320IPR010402CCT domain
PROSITE profilePS5101715.944278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MTSHQNIKIS EKIMISKYQE DVKQPRACEL CLNKHAVWYC ASDDAFLCHV CDESVHSANH  60
VATKHERVCL RTNEISNDVR GGTTLTSVWH SGFRRKARTP RSRYEKKPQQ KIDDERRRED  120
PRVPEIGGEV MFFIPEANDD DMTSLVPEFE GFTEMGFFLS NHNGTEETTK QFNFEEEADT  180
MEDLYYNGEE EDKTDGAEAC PGQYLMSCKK DYDNVITVSE KTEEIEDCYE NNARHRLNYE  240
NVIAAWDKQE SPRDVKNNTS SFQLVPPGIE EKRVRSEREA RVWRYRDKRK NRLFEKKIRY  300
EVRKVNADKR PRMKGRFVRR SLAIDS
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G49130
AtGenExpressAT1G49130
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G49130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G49130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3173810.0AK317381.1 Arabidopsis thaliana AT1G49130 mRNA, complete cds, clone: RAFL25-23-K13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_175339.20.0zinc finger protein CONSTANS-LIKE 8
SwissprotQ9M9B30.0COL8_ARATH; Zinc finger protein CONSTANS-LIKE 8
TrEMBLF4I1N00.0F4I1N0_ARATH; Zinc finger protein CONSTANS-LIKE 8
STRINGAT1G49130.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8021649
MalvidsOGEM150481517
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  4. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]