PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G48000.1
Common NameAtMYB112, MYB112
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 243aa    MW: 28291.9 Da    PI: 8.8884
Description myb domain protein 112
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G48000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-183481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +lv ++ ++G g+W++ +r  g++Rt+k+c++rw++yl
      AT1G48000.1 34 RGPWTVEEDMKLVSYISLHGEGRWNSLSRSAGLNRTGKSCRLRWLNYL 81
                     89********************************************97 PP

2Myb_DNA-binding45.61.6e-1487130146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg  + +E+ ++++++ ++G++ W++Ia++++ gRt++++k++w++
      AT1G48000.1  87 RGDISLQEQFIILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 130
                      5666889***************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.4912985IPR017930Myb domain
SuperFamilySSF466891.5E-3032128IPR009057Homeodomain-like
SMARTSM007172.1E-153383IPR001005SANT/Myb domain
PfamPF002499.5E-173481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-213588IPR009057Homeodomain-like
CDDcd001671.02E-103681No hitNo description
SMARTSM007178.1E-1386134IPR001005SANT/Myb domain
PROSITE profilePS5129416.09486136IPR017930Myb domain
PfamPF002492.9E-1387130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2189134IPR009057Homeodomain-like
CDDcd001676.64E-991130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009047anatomystem
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MNISRTEFAN CKTLINHKEE VEEVEKKMEI EIRRGPWTVE EDMKLVSYIS LHGEGRWNSL  60
SRSAGLNRTG KSCRLRWLNY LRPDIRRGDI SLQEQFIILE LHSRWGNRWS KIAQHLPGRT  120
DNEIKNYWRT RVQKHAKLLK CDVNSKQFKD TIKHLWMPRL IERIAATQSV QFTSNHYSPE  180
NSSVATATSS TSSSEAVRSS FYGGDQVEFG TLDHMTNGGY WFNGGDTFET LCSFDELNKW  240
LIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-252513418126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.169150.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO153753070.0
Genevisible259618_at0.0
Expression AtlasAT1G48000-
AtGenExpressAT1G48000-
ATTED-IIAT1G48000-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269|PubMed:22301384}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB112).
UniProtTranscription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}.
Function -- GeneRIF ? help Back to Top
  1. MYB112 constitutes a regulator that promotes anthocyanin accumulation under abiotic stress conditions.
    [PMID: 26378103]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G48000.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G48000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2290830.0AK229083.1 Arabidopsis thaliana mRNA for putative transcription factor MYB112, complete cds, clone: RAFL16-36-L19.
GenBankAY5195620.0AY519562.1 Arabidopsis thaliana MYB transcription factor (At1g48000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564519.10.0myb domain protein 112
SwissprotQ10MB45e-85MYB2_ORYSJ; Transcription factor MYB2
TrEMBLA0A178WKB20.0A0A178WKB2_ARATH; MYB112
TrEMBLQ94CJ30.0Q94CJ3_ARATH; MYB transcription factor
STRINGAT1G48000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  4. Rizhsky L, et al.
    When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress.
    Plant Physiol., 2004. 134(4): p. 1683-96
    [PMID:15047901]
  5. Xin Z,Zhao Y,Zheng ZL
    Transcriptome analysis reveals specific modulation of abscisic acid signaling by ROP10 small GTPase in Arabidopsis.
    Plant Physiol., 2005. 139(3): p. 1350-65
    [PMID:16258012]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  8. Yang A,Dai X,Zhang WH
    A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.
    J. Exp. Bot., 2012. 63(7): p. 2541-56
    [PMID:22301384]
  9. Chen X, et al.
    The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway.
    Plant Cell Physiol., 2014. 55(3): p. 604-19
    [PMID:24399239]
  10. Lotkowska ME, et al.
    The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress.
    Plant Physiol., 2015. 169(3): p. 1862-80
    [PMID:26378103]
  11. Lv Y, et al.
    New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis.
    Plant Cell Environ., 2016. 39(3): p. 556-70
    [PMID:26381647]
  12. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]